CAZyme Information: MGYG000002903_00188

Basic Information

• Species: Negativicoccus succinicivorans
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae; Negativicoccus; Negativicoccus succinicivorans
• CAZyme ID: MGYG000002903_00188
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		60609.9	9.2009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002903	1204906	MAG	United States	North America

• Gene Location: Start: 8950; End: 10563 Strand: -

Full Sequence      

MNGSLWRKYGGLFLLALITLCAFNWNLPVTDPVESNYALTAKEMVLAGNWISPQIYGHYW
FDKPIFAYWLLEISYALFGFGDFASRLPGAVMGAATVVMAGVLGECFWRRKDAYWYSGLF
LLTTFAFWVLSRGVVTDPALLLWTAVTMYGAYRGLTENSRRCMMLAYAGAGLAVLTKGPV
GLVLPGLILLIWLAVTPSVRRWKRLFDPAGIAAFFLVAAPWYVTMYMAHGADFIQGFLGL
HNITRATVSEHPEDNHWYYYLLILPLSVLPWTPLALREIVRARWETSAAYRFCVVWTVVT
LLFYTAMATKYITYTYIAILPLVLLAVRAWLYAVDSGRNTYDACLTVPAFFMTALYLGGM
AYLNRMLIGLAAVLLIFFAYTLWRSRRSGSRAGLFARVAWMLVIASLLLTAEGLPSVLRD
RSTEELASAWAAEPGVHYCYRSYTTSFPFYTGIVPIFADRNEEKNEVWAGKYTMPQVTKE
EFVAALKGHEQVTLLVPRSQRKNFVNEPYAPLLQLKERFHSGDIYVNTASLRTAEGQ

Enzyme Prediction     

No EC number prediction in MGYG000002903_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	498	3.5e-93	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.99e-47	5	403	6	423	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.95e-32	7	385	4	375	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.02e-16	62	221	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	7.25e-11	34	223	32	232	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
PRK12363	PRK12363	0.004	182	298	4	118	phosphoglycerol transferase I; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	3.49e-136	7	508	27	531
AOH39318.1	1.83e-124	13	531	17	542
AXL21032.1	1.20e-119	13	525	8	534
ARG00055.1	8.53e-119	12	526	10	535
AXB83023.1	2.13e-118	12	512	7	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.20e-23	29	310	54	344	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TBG8	1.47e-31	13	337	7	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
B4ETL9	1.73e-30	11	376	10	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
Q57M54	5.51e-30	13	337	6	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=arnT PE=3 SV=2
B7VBN0	5.60e-30	32	339	30	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	1.38e-29	32	339	30	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999979	0.000015	0.000035	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
5	27
86	108
113	135
173	195
208	230
257	276
289	308
312	334
343	362
366	383
396	418