CAZyme Information: MGYG000003329_00506

Basic Information

• Species: Veillonella sp900550455
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900550455
• CAZyme ID: MGYG000003329_00506
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000003329_11|CGC1	55375.62	8.6243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003329	1615634	MAG	United States	North America

• Gene Location: Start: 88773; End: 90224 Strand: -

Full Sequence      

MKLLLNEKYHIWILLIIASIIYFIGNGLMPVTDPIESNYALTAKEMLENNNYLSPQIFGH
FWYDKPILFYLETLVAYKIFGISDFSSRFFPSLLALVNIGLIYWFVKKQTNHKVALVAAT
ILATTIEHWIIGKAVITDMTLGLCFNACLMAFYLGYMQDKGKRYYYLAYLASALAVLTKG
PIGFLLPGLIILVYLAIQKDLKEILHLHLITGIIIVLLLGGSWYYYMYAYHGQDFIDVFL
GVHNWLRATVSEHPRFNVWYYYLVITLIALFPWTILLPKFLYQNRKVWLHNTRLHSFLAV
WATIVILFFSCMATKYDTYTFPALAPIVILIAILCQEKARLIYKLGFAIALIYCLLTMLL
AIPLMNNAAATKTGYYISHNIDPNALVISGQGKYRVSTTFYGNHDVYKLLPPKTEAPDVT
AISWNAKQVMPMISADALPNDKEIFLLTDKNIESQTVLDLLEKHTWQLIMTTDEGSIYQL
KSY

Enzyme Prediction     

No EC number prediction in MGYG000003329_00506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	373	2.4e-94	0.6796296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.56e-51	4	334	3	335	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.96e-25	6	332	3	330	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.31e-12	64	219	1	153	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.32e-08	11	236	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.66e-06	63	419	64	454	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU35875.1	1.52e-210	6	480	7	483
CAB1274717.1	1.03e-203	6	480	7	483
AVO27725.1	1.06e-122	13	482	30	510
AVO74995.1	1.69e-121	13	482	30	510
CCC74317.1	1.69e-121	13	482	30	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.46e-24	12	330	33	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.57e-31	13	332	7	318	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	9.72e-23	8	328	2	303	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	4.27e-22	12	332	6	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	4.27e-22	12	332	6	327	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q8D339	1.94e-21	16	332	20	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Wigglesworthia glossinidia brevipalpis OX=36870 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000008	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
9	31
89	106
134	156
166	197
204	226
259	281
294	313
318	335
342	364