CAZyme Information: MGYG000003857_00516

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; RUG841
• CAZyme ID: MGYG000003857_00516
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000003857_24|CGC1	63443.28	9.3042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003857	1817818	MAG	United States	North America

• Gene Location: Start: 6564; End: 8216 Strand: +

Full Sequence      

MLKEFYEKHRNALFVLSVAIVTYFLYFHNLGNFKLLDVDETRYVDMSRYMRETGDYMTLF
LNGEYFFEKPPLYFWLENVSFAIFNAVNEFTARVPGCVEGILTALVLFFTTKKFTKNTKL
ATISALVLLCSAEFLILSKTAILDILLGAMVTISVLCGFMTFSVEEKQKKFYWWGFYLFS
ALGVLGKGIPAIAVPFGIMFVAGLYTKKLKEYFKPQYFLVGLLMFFAVVIPWHKLMLSMY
DPLFFDEYIIKHHIARFLGSDVIHRERPLLYFIPVILWGTLPFAHSFIALIVEKLSKLKN
FKGFKNISIPKFEEMNEESKFLSLCLIGAIVTLLFFSSSGTKLITYIIPIYPYLAVIIAK
YWLEYIENSDHKKCIEISSEIFNYLLVVAGIGFAVAINFLPEPIKGDFQTIALPVIFTVV
VFPVLGLVAIKKDNRKLLLASYILFMASLSGFAYDKILEMNYRFGQNDLVEFAQYAKDNH
LNIYTFKTGKRYSLLYYSGKQAVFNIPEEDFVHVISEPNNIIIIRKKNFDELPSKATVIK
EGRKYLLLKK

Enzyme Prediction     

No EC number prediction in MGYG000003857_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	12	504	3.6e-94	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.39e-36	8	514	4	485	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.99e-25	8	453	3	427	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	4.79e-11	11	232	1	230	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.51e-07	69	232	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	1.28e-05	15	272	27	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	2.53e-142	4	549	6	555
ADB95323.1	1.09e-45	6	392	10	395
QEM66831.1	3.11e-43	5	372	8	355
ACB50888.1	2.63e-42	6	407	17	431
ACH39987.1	1.12e-41	7	358	13	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.41e-20	12	357	35	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	9.11e-25	17	397	11	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A1JPM4	1.26e-23	12	389	10	363	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q7N3Q9	7.14e-23	20	369	19	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
C6DAW3	1.29e-22	17	406	10	383	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
A8FRR0	1.65e-22	16	449	8	417	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	30
90	109
140	162
182	204
217	236
270	292
321	340
344	366
379	401
411	430
437	454