CAZyme Information: MGYG000000046_00170

Basic Information

• Species: Megasphaera stantonii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera stantonii
• CAZyme ID: MGYG000000046_00170
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000000046_1|CGC2	39144.15	8.2706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000046	2558124	Isolate	United Kingdom	Europe

• Gene Location: Start: 190722; End: 191768 Strand: +

Full Sequence      

MINLRHKRIIVTFLMHLGDLVLITPFLQVLRRHAHGSDITLVVDEKVADVVRYNPNVDHI
VTVDKKGKDNSVGALWRIGRELHKNHYDILINLHPNERTSFLAAAIQAKQFVGMSHFLIR
PFMDTYTRLDRLHFHAADMYLNVLVQLGIDDYRNDGLQLVTCPAWDKTADDFYASQGVGP
NDKLVGFNIGSAVPQKRWPPDRFAAVADYFADKGYTCVFFGGTMDEEMVGEAVSLMRHKP
VVGTGKFSIGELAAAIRRCSLFITNDSGPMHIAVSQRVPLVALYGPSNPKFYGPYTDRAI
VLESTTHYEVGKSMKKIIKEGKYKGISVIPLSQVIQAGEELLERYKEE

Enzyme Prediction     

No EC number prediction in MGYG000000046_00170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	76	305	5.1e-53	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.74e-67	8	337	1	274	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.75e-54	6	343	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.80e-37	76	324	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.31e-29	7	342	6	343	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	1.34e-26	18	343	11	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL20515.1	3.55e-259	1	348	1	348
ALG42175.1	2.62e-211	1	345	1	345
AVO27634.1	2.62e-211	1	345	1	345
CCC73399.1	2.62e-211	1	345	1	345
AVO74798.1	2.62e-211	1	345	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.40e-139	3	342	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	9.34e-18	185	336	183	337	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	9.37e-29	18	342	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	5.65e-21	18	342	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P45042	9.06e-19	18	323	12	324	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q57336	2.32e-18	7	334	9	334	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P37692	3.20e-18	184	336	182	337	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.983033	0.016644	0.000191	0.000055	0.000028	0.000055

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000046_00170.