CAZyme Information: MGYG000001312_00247

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_00247
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001312_39|CGC2	40354.97	9.4986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 96328; End: 97392 Strand: +

Full Sequence      

MKILIIKLRNIGDVLLISPLFYNLKKYYGDSCILDVLVNAGTEKILQTQYLNQIHTLKRN
PNKLQRIYDELALLKAIKKEKYDMVIGLTNGERSAFLAFWSGAKIRVGFPPNSFWSKNLY
THKLTPKRQHNLEDNLEALRILNIPILSKKVLAPIPQKTTNLNNLPPHFIHLHFFSRLFF
KCLDDSFCAKIIDTITQTYHIPCVLTAAKDSRESKKLQNILKLCHSKPLYFDGTLTLPEV
SLLNSKALAFVGVDTGIMHLSAANNIPTFAFFGPSVVASWGPWDNDLDSSTYNKQNGIQQ
MGKHFVYQEDFDCIPCGRTGCNDTKISDCLLSRLNQQKALSYLLDFLNNIIRHH

Enzyme Prediction     

No EC number prediction in MGYG000001312_00247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	324	1.3e-39	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.47e-46	1	349	2	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.23e-39	2	330	1	263	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.91e-34	2	287	7	303	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	2.43e-19	71	283	2	220	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	0.002	235	274	242	281	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ07015.1	4.67e-258	1	354	1	354
AWI34972.1	1.87e-151	1	351	1	348
QOQ98441.1	3.82e-148	1	352	1	354
CAE10915.1	1.39e-104	1	349	1	353
VEG81074.1	1.39e-104	1	349	1	353

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	6.71e-27	8	287	1	291	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	5.68e-23	8	287	1	291	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P44011	1.02e-08	2	318	3	314	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_00247.