CAZyme Information: MGYG000001552_00603

Basic Information

• Species: Butyricimonas synergistica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas synergistica
• CAZyme ID: MGYG000001552_00603
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		41662.15	8.8182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001552	4964733	Isolate	not provided	not provided

• Gene Location: Start: 373215; End: 374270 Strand: -

Full Sequence      

MPVKKVLVIRFRRVGDAVLSVVICSTIRKSFPDAEIHYVVNESIEPLFRDHPDIDRVITF
SDRENNHFFTYLVKVYRLMRKERYDVIVDTRSTLKTLWFSIFSLGTKYRIGTRKYYNLFF
HNYRLRNQQYEELDEVSRNLLLVKPLEREGQIVYETDFKLQVTDEERDGFRRYMVERGID
FSRLVVLCTPFTRVVDKKWDILKMKEVLSRLVWKYNAQLIFNYSKEEKAEALALYDEMEG
DKHIFVNVEADSLRKLVAMLSLSDFFFGNEGGPRHMAQACGIPGLAIYPPWVNKQKWLPS
RDERYQGISPLDFIPEAERGMLLDGEMFDRLTVEQVWDRLDGMLRKIKKST

Enzyme Prediction     

No EC number prediction in MGYG000001552_00603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	304	5.2e-30	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	6.48e-49	3	348	1	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	9.21e-44	5	341	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	6.39e-13	2	318	4	334	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	3.18e-10	74	296	3	225	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS29620.1	2.53e-170	1	347	1	347
QRO51368.1	6.28e-170	1	344	1	344
BAR51520.1	2.06e-117	1	344	5	347
BAR48400.1	2.06e-117	1	344	5	347
AEW22458.1	2.06e-117	1	344	5	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.06e-07	4	290	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	2.93e-10	15	318	5	322	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	5.55e-09	15	330	5	340	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001552_00603.