CAZyme Information: MGYG000002634_00101

Basic Information

• Species: Haemophilus_D parainfluenzae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_K
• CAZyme ID: MGYG000002634_00101
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		40337.21	9.09

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002634	1948050	MAG	China	Asia

• Gene Location: Start: 94850; End: 95881 Strand: -

Full Sequence      

MNKLKALRLKIGKWILDKSSRSNNPQSLEHPKSFLFLRQDGKIGDYIVSSFVFREIKKFN
PLIKIGVICTKQNAYLFQRNHHIDEIYLVKKRNILDYIKTALFIRKERYDVVIEPTLVLR
NRDLLLLRILNARNYIGYRKADYNIFNINITKDGHFSEIYKEALAQSNISLSDDSYDIPQ
DGSTKEEILQFITDNQLNNYITINFYGAGKNRKFNDTHVIDYLAYIRNHRKCPLILLSTP
DTHEHLSRIANQFDDVFVYPNPHTTIYHTIELIRNCALLISVDTSTIHIASGLNRPMICF
YSQDKENFTHWHPNSKNACHIIHYHDNVNEISPREIKPEWLDI

Enzyme Prediction     

No EC number prediction in MGYG000002634_00101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	104	329	1.1e-24	0.88

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	5.65e-33	31	339	1	320	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.84e-21	35	335	3	254	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.81e-04	223	321	129	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	0.001	44	321	17	306	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	0.005	263	309	249	295	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR23456.1	4.28e-253	1	343	1	343
QOR20040.1	1.43e-251	1	343	1	343
AFJ20732.1	3.37e-250	1	343	1	343
AVJ01113.1	1.26e-245	1	343	1	343
AVI99265.1	1.26e-245	1	343	1	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	2.48e-13	32	322	41	330	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002634_00101.