CAZyme Information: MGYG000002893_00384

Basic Information

• Species: Haemophilus_D parainfluenzae_N
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_N
• CAZyme ID: MGYG000002893_00384
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000002893_6|CGC1	38088.76	9.2053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002893	1897749	MAG	United States	North America

• Gene Location: Start: 8621; End: 9649 Strand: -

Full Sequence      

MKILVIRNDKLGDFVQAFPAFAMLKASNPELKLTALVPAYTAPLAQICPYLDDVIIDSAK
NDKADFNRLVKEIKEQQFDGMISFFSNTHNGKLAWKSGIPYRLAPATKWVQILYNHRLTQ
RRSRSEKSEAEYNQDLARAFLKKHNMPIVEPKPPYLSLPESAVKNQRVFLQEQLGLSADK
KWVFVHSGTGGSATSLSLTQYAQLIQGLLSEFDCQIILTAGPGESEKAHELAAKIDSPNV
VVYDKNKGLVDFSHSLACADLFIAGSTGPLHLSSAFNVPTIGFYPNSRSSQPRRWKPIND
ADKHLAFCPPKGKEEMNLGLISIENALGDIIPFVRKMWQSSN

Enzyme Prediction     

No EC number prediction in MGYG000002893_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	68	316	2.8e-33	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	5.10e-79	1	338	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.09e-56	2	332	1	268	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.84e-14	68	305	3	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR14420.1	6.01e-246	1	342	2	343
QAT96035.1	4.94e-245	1	342	2	343
QOR20192.1	7.01e-245	1	342	2	343
QOR25653.1	9.96e-245	1	342	2	343
VEI30138.1	1.94e-244	1	342	1	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44011	2.04e-209	2	342	3	344	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002893_00384.