CAZyme Information: MGYG000003189_00211

Basic Information

• Species: Haemophilus_D parainfluenzae_M
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_M
• CAZyme ID: MGYG000003189_00211
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000003189_2|CGC2	39455.67	8.5699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003189	2132219	MAG	United States	North America

• Gene Location: Start: 80622; End: 81677 Strand: +

Full Sequence      

MSHSPLFISPPKSLCILRLSAVGDVCHALAVVQHIQRYWPQTQLTWIVGKTEMGLLSGIE
GVELIPYDKKSGWKGVWNLWMFLKNNKFDALLNMQTAFRASIISLGIQAKYKIGFGKKRS
REGQWLFVNHRVQDPETPHVLDGFMAFADYLGVPPAEMLSWQLAIPDSDREYAKQFLDPT
RKNLIISPCSSKAEKDWLVERYAEVANIAHQHNVNVIFCSSPAKRELEMVKKITALCDFQ
PVDASGKTSLKQLVALIHQADLVISPDSGPAHIATTQGTPVIGLYAYHNPLRTAPYYNLD
NVVSVYEENVQKEQGKPSSELPWATKLKGKNLMVEIQVDQVVAQMRALNLF

Enzyme Prediction     

No EC number prediction in MGYG000003189_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	304	7.6e-50	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.54e-83	11	321	1	314	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	9.66e-81	76	324	1	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	2.00e-66	13	347	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02193	heptsyl_trn_I	6.37e-30	15	296	3	291	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.15e-21	10	285	4	288	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR06383.1	9.73e-254	1	351	1	351
QOR10620.1	1.38e-253	1	351	1	351
QOR08230.1	1.38e-253	1	351	1	351
QOR15529.1	5.63e-253	1	351	1	351
QOR17534.1	1.61e-252	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.08e-20	12	338	9	337	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.30e-203	5	351	2	347	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	1.74e-16	23	312	5	301	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	4.19e-16	23	298	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000096	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003189_00211.