CAZyme Information: MGYG000003630_00163

Basic Information

• Species: F082 sp900771045
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; F082; F082; F082 sp900771045
• CAZyme ID: MGYG000003630_00163
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000003630_30|CGC1	36911.67	9.0429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003630	1926154	MAG	Fiji	Oceania

• Gene Location: Start: 2037; End: 3020 Strand: +

Full Sequence      

MRKFLVIQTASIGDVILATALIEKLHGTYPDAEIDFLIKKGYENLFSMHPFLNELIIWDK
KNGKYRNLLQILKKTRGKRYDAVVNVQRFAATGLLTAFSKAEMKIGFDKNPFSFLFNKKV
RHIIGDGRHEVQRNQELIADITDGVPAKPRLYPTEQDFDSVKQFKTREYICIAPCSLWFT
KQMPEEQWVKFAASLPKGLKVFLLGGKDDNDVCERIRVKSGNGDITNLAGQLSLLRSAAL
MRDAKMNFVNDSSPMHLAASQDAPTTAVFCSTTTDFGFGPLSSDSCIVETREKLECRPCG
LHGFRQCPKGHFKCGYSIDLQELTNRL

Enzyme Prediction     

No EC number prediction in MGYG000003630_00163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	311	1.2e-45	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.11e-53	1	327	1	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.40e-50	3	319	1	267	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	1.90e-28	73	313	6	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.78e-24	2	272	6	291	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	3.73e-24	3	314	1	316	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC67706.1	4.82e-143	1	325	1	325
QEC54217.1	5.91e-138	2	327	15	343
ARS37596.1	2.01e-131	1	327	1	327
QES90528.1	2.48e-131	1	327	1	330
AEV98342.1	3.40e-131	3	327	2	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.00e-10	2	322	9	335	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	8.35e-16	2	269	9	281	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	1.06e-13	13	272	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999915	0.000154	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003630_00163.