CAZyme Information: MGYG000000243_00003

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_00003
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		76898.75	6.5516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 525; End: 2558 Strand: +

Full Sequence      

MSNILKLTLICSLIFHVLMGKAAGVGELKQIKENYRQMLIPSSIEQDSLLSDLIKIKPEK
EMSDQAVVELHQLYPFDLKKIDGYLSLMSADGSWTDINYADTKRSGWEPKLHAERILELS
KLYYSKTTEYYHSEKVKEAIHLALKYWFDTKPRCLNWWYNQIGIPKTLGAAFILLEEQLT
DQEHRAAVAVMENAKFGMTGQNKVWLAGNVLIRALLQNDADLVKAARDAIASEIVLGRKE
GIKDDWSFHQHGPQQQFGNYGLSFVTGMSFFFQLFKDTDYEFTGQQREILVSLIDKGYRW
VIWNRYMDVSSLGRQFFHNAQIHKAYSLVFAAEDMGLAGFPAHGNTLIGYKHFDDSDYTV
HRSKDWMSSVKMASRRVIGTELVNEDNLKGYYLGDGATYYYVRGDEYLEVFPFWDWRKIP
GVTSYEDIAPMPNVNVTRSGNNSDLVGGLSNGKIGMTAMELNRDGLEAHKVWLFADKFVF
CLGADIHSDTTLCVTTSIDQRSKSGELYVWNKKKWSAITGAEAFRQKDLRFFHDAVGYIV
LDGDTCVAQSEEREGRWSDFMGMYTPATLHGEVAALHLRHGVKPSGASYQYIVLPAATKK
EVEEFDPKMIRVIKNDKVAQVVSSPACGEGYWMAVYQSENFDIEGLFFKAVLPGIYYVEK
GLGGLEIKLSSPFRISK

Enzyme Prediction     

No EC number prediction in MGYG000000243_00003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	351	596	1.4e-65	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.32e-147	52	672	11	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	9.66e-88	351	598	2	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	7.30e-36	79	314	27	282	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71119.1	1.33e-259	3	664	2	680
QUT90440.1	1.43e-256	3	664	2	680
ALJ58447.1	3.30e-255	3	664	2	680
QUT47778.1	1.20e-233	27	672	27	688
QCQ51442.1	1.29e-229	5	656	6	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	3.34e-82	85	672	32	620	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	5.34e-82	85	672	54	642	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RW9_A	1.15e-34	149	622	117	658	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
1RWA_A	1.15e-34	149	622	117	658	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
6F2P_A	1.93e-27	156	632	122	662	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	2.93e-81	85	672	54	642	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	9.81e-23	156	640	146	695	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	9.40e-17	155	660	181	755	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q53591	3.50e-14	156	660	370	961	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
P59807	6.25e-09	349	622	621	912	Chondroitin sulfate ABC endolyase OS=Proteus vulgaris OX=585 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999195	0.000154	0.000142	0.000133	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_00003.