CAZyme Information: MGYG000001385_00167

Basic Information

• Species: Alistipes_A indistinctus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A indistinctus
• CAZyme ID: MGYG000001385_00167
• CAZy Family: PL8
• CAZyme Description: Xanthan lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		86529.74	4.9992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001385	2850981	Isolate	not provided	not provided

• Gene Location: Start: 189535; End: 191904 Strand: +

Full Sequence      

MAHTISRRALSVLASLLLLGGLFASCAKQSPLSFDQMRERYYLTLVPDADLSDTLVQRRI
NALDDAAGPLWESLNKAPDRGWLWEENKDTTVSMMMGGNFAKLNTLAAAYRTKGSRYYGN
PEMKADILAGLDWAIASRYNPSVEWYDNWWDWVIGVPMTLNNTLVLMYDDLSPEQLRAAL
GAMDHFAPDVTYEGAATGANKIWQCGIMAVRGILGQNPDQLKMAVDGLGTEFKYVTGKDG
FYEDGSFVQHQWHPYTGGYGRSMLSQMADLIALLSGTPWAVPQPYEAMLYEWIHNGYEPL
VYRGAMMDMVRGREISRPGCTDRWAGHSILVSMLRLSEVAPAAEKERLQAFVKANVLSDD
NRDFMQDVPTYLLASARALMADGEVKPEAPQTLNKVFGAMDRAVHKRPGFALGIAMSSNR
IENYETINGENLCAWYTGDGMTYLYDNDLAQYSDSFWPTVNPYRMAGTTEDTRVREAKTL
PFGPGLLYADGYKSPQHWVGGSSIEGRYGMAGMWYDAQDCTLEAKKSWLMAGDEIVALGA
GISSTDGRTIETTVENRKMNPGADYRLTLDGEAVLAADGVLNAPSAHWAHFAGVDEHTNV
GYWFPQPATVNLQREARTGSWYAISQPYNPKEPITRSYFTLWLDHGKSPKDATYAYVLLP
GRDAAATAAFAAAPGVEILANTPQVQAARNTKEGVTGFSFWEAAGPVAGVSADAPASVIV
HETPETITVGVSDPTHLNTGAVRVTLSEAKAAKVAEEHPEVKVVSLSPVVLEVGMDGSLG
RTRSVTLRK

Enzyme Prediction     

No EC number prediction in MGYG000001385_00167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	395	663	1e-95	0.9845559845559846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	34	734	2	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.74e-104	394	663	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	3.01e-97	49	354	11	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	1.47e-14	679	740	1	65	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG53521.1	0.0	1	789	1	789
BCG54808.1	3.93e-308	37	785	1	767
BCG53520.1	8.46e-246	5	789	10	802
QYR20590.1	2.27e-201	12	780	13	770
QLD12808.1	5.31e-196	35	787	49	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1J0M_A	6.45e-180	34	782	4	744	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
2E22_A	5.11e-179	34	782	4	744	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
2E24_A	7.22e-179	34	782	4	744	ChainA, Xanthan lyase [Bacillus sp. GL1]
1X1H_A	8.07e-178	34	782	4	744	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]
6F2P_A	9.22e-177	34	785	6	747	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	5.43e-176	34	782	29	769	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	1.87e-91	73	697	332	953	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q59801	1.53e-87	56	661	73	692	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
P0CZ01	4.38e-83	103	789	111	798	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1
Q53591	9.97e-83	50	686	270	923	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000069	0.000133	0.998175	0.000001	0.001631	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001385_00167.