CAZyme Information: MGYG000003721_00477

Basic Information

• Species: Peptoniphilus_C urinimassiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_C; Peptoniphilus_C urinimassiliensis
• CAZyme ID: MGYG000003721_00477
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1121	MGYG000003721_29|CGC1	122551.91	5.7595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003721	1482893	MAG	Canada	North America

• Gene Location: Start: 86; End: 3451 Strand: +

Full Sequence      

MVVTLKGDNLDPTDIKSTIRIRMDLQDIPVKWEKSSEGLQATLTFPANETEKRIAYSLYF
EIKGDLSQNQSGKVYVTTEEATTSPKVTGLSATPEKLTDAGGNVALNVIAENAKAGDIQW
TVKKDGREDPLLKPISTGGLNFTLALPKNDTENDITYTVEAKAANDAQGKTAKITVAKMA
ATPPVVQESEITMMTDVNEKIDAASSEKTFPVIATPNTDAKNVKLHITADGKAVTLPYTV
TGAKSKKTVTITFPENKKASPVVYKITFNATGSESVFQDDPVATFTQAAGEAVNASISSV
TATNDQLPLAGGNTTVTIKGTDLDKADLVTKLFKVEDGKETEVKLGDYMTGSFQGRDNVQ
SASFTFPKVDKDTHFVFKASVDGGNTFVEKAIHQTSEGSNRETEALEPKKVFTILDNTLV
VDFHEPVQEARANAIMKNVHILAGSDTVNIGPDDKVTFDGNTLQIKFKDPIFKDVKTYKL
VVDARTFKLFNEKENREKENKAFESIIQKDGPYIEDAKFEQGYKLESEGGKVVLKLKGYN
LPEDLKVKILENDKEKTLLDVTPEITGSPNERIITFSAPANTTDRVQSYSILVSTDSVQY
SSEVSNMQNRFRRMVVSVLPKDLKADAPQIDFMQIQSYGNADNGDITHTNLPTGQESKKT
LVWIYGANLNADHTRLRLKDKNGVYWSPIYDATQDSGTRILMTMLDGMHGGTPGMTGKGN
NMLMEVILPRGYQPDNWNGYEKGTTFKYEVAPDGVNFDSEVTVTATVRFDGEDSKKDLTP
LLTDVTVRHVDKDGKDIVPAEKVKAYNHLHPCDLQKLLPLRDKDGFKKDFEGYKVADTDE
IVKGMEGPNHYGSAYYDGKTVKELKNSKGEIVLVYGKAEKPVDPSNPSDPTNPSNPSTPS
KPDSPSDKGSGSGHVVLPSAPANKVVKPEEKPAPKKETSTTLTKGYIAGYPDHTFRPAKS
MTRAEAAAILARLCKLTGADTSKPDFKDADGWYNAAINDVVKAGYMKGYPDGSFKPDQPI
TRAEFAAILSHVLKDTTAPNPFKDTAGHWAKDAIDKAYAQGIIKGYGDNSFRPDALVSRA
EAVAMANRTFRLQKTVVDNPFTDISPDHWAYNDILTAVSNK

Enzyme Prediction     

No EC number prediction in MGYG000003721_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
SLH	986	1025	2.2e-17	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	2.84e-14	985	1121	581	723	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
NF033190	inl_like_NEAT_1	1.33e-13	909	1081	561	743	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	4.24e-11	986	1025	1	42	S-layer homology domain.
pfam00395	SLH	7.77e-11	1042	1082	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	1.91e-05	935	1034	652	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF46401.1	2.15e-33	946	1119	1203	1379
QUL56471.1	1.06e-32	946	1120	1120	1298
QOS78172.1	1.41e-32	925	1114	1095	1302
QLG41554.1	9.46e-32	925	1121	1083	1297
QKS46422.1	6.64e-29	946	1121	1125	1304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PYW_A	1.81e-16	942	1100	22	185	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]
6BT4_A	1.11e-15	942	1089	43	195	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
4AQ1_A	6.61e-09	926	1092	7	170	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]
4AQ1_C	6.61e-09	926	1092	7	170	Structureof the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2 in complex with nanobody KB6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06848	2.10e-31	946	1118	242	427	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1
Q06852	2.03e-30	944	1118	2101	2293	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
Q06853	1.73e-29	946	1120	483	669	Cell surface glycoprotein 2 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_3079 PE=1 SV=1
P49051	2.81e-13	942	1089	51	203	S-layer protein sap OS=Bacillus anthracis OX=1392 GN=sap PE=1 SV=1
Q9ZES5	4.86e-13	942	1089	51	204	S-layer protein OS=Bacillus thuringiensis subsp. finitimus OX=29337 GN=ctc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003721_00477.