CAZyme Information: MGYG000000001_01847

Basic Information

• Species: GCA-900066495 sp902362365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp902362365
• CAZyme ID: MGYG000000001_01847
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000000001_27|CGC1	65054.04	4.6522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000001	3219617	Isolate	United Kingdom	Europe

• Gene Location: Start: 164; End: 1924 Strand: -

Full Sequence      

MVNLRIKPYNLDDEGVKWVQDTIANMTIEEKIGQLFINMGASRDEEYLKGVLDNYHIAGV
RYNPGTAEEVYEQNRILQENSKIPLLIAANTESGGNGACVDGTYIGNEVKIAATNDKRYA
YEMGRVSGVEASAIGCNWSFAPIVDINRNWRNPIISTRTWSEDVDQTLELSLEYMRGIME
SGIAPAAKHFPGDGIDERDQHLSFAPNHLSVEEWDETFGKVYGGLFEAGLPSIMAGHISL
PSYVRHFNPEATVQEQILPATLNKYILTDLLRGKMNFNGLVVTDASHMVAMTSAMKRSEM
LPTAIAAGSDLFLFFNDPDEDFAWMLEGYKNGIITDERLEEALTRILGTKAALGLHKKAK
TEILQPKEEAMAKIGLPENVAIATEVADKAITLVKNNEDIFPISVEKHKRVLLVDVKGTE
GGFGALIGAQGPKPTEILKAQLEEEGFEVSIWESPIEKIMSLPTEERRKAIGSIYAARRP
ISDLTDNYDLIINVAVVNPNTDQRIQWPASKGTPDIPFYVNEVPTIFVSVQCPFHLADVP
QVKTYINTYDNKDITLKALVEKMLGRSEFKGVSPVDAYCGLLDTRY

Enzyme Prediction     

No EC number prediction in MGYG000000001_01847.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	313	3.1e-49	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.86e-68	26	449	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.92e-64	27	347	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	2.30e-19	19	414	38	416	beta-glucosidase BglX.
PRK05337	PRK05337	8.99e-18	117	319	96	284	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10202.1	0.0	1	586	1	586
CED94841.1	0.0	1	586	1	586
AEB30748.1	0.0	2	586	3	586
SQI02299.1	0.0	1	586	1	589
AMN34377.1	0.0	1	586	1	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	6.44e-135	4	585	6	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	9.29e-50	23	576	39	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.18e-49	23	576	13	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.89e-49	23	576	43	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	5.05e-46	26	574	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.56e-147	1	584	1	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	5.09e-49	23	576	39	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	4.48e-26	73	397	88	420	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q2UFP8	1.17e-21	19	407	57	470	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
Q3J953	2.55e-21	116	330	93	297	Beta-hexosaminidase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000001_01847.