CAZyme Information: MGYG000000002_00014

Basic Information

• Species: Blautia_A faecis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A faecis
• CAZyme ID: MGYG000000002_00014
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1237	MGYG000000002_1|CGC1	136473.89	3.7994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000002	4433109	Isolate	United Kingdom	Europe

• Gene Location: Start: 15841; End: 19554 Strand: -

Full Sequence      

MKKRKQLGRVTVIAVSTALMATSSGVAVMAEAESIPTEISNLRVGNYTEPLAVEDEKPVF
SWQMDSQLHGQKQTAYQIVVTKEATGDVVWDSQKQEDSASVDISYNGDSLEPETAYQWTL
TVWDKDGKEYTQTSRFETGIMNPDLEGWDGAEFIGTTATALDATSACVWHINTDMQITEG
NKASLIVGANDYRLNDQFQNVENVEGENYIRLEFDFSGVSAGNGAKLNIYRVGYAQGDSA
DTPYLTISAADTEDTNIDELFTPENINDVHNIDIYCETGNITIKVDDQELFVGPEQEGRF
GTSRPSLTVSPLSTGNNYNTFPNLNSIGFSTEDGCKATFSNYQIIDIGQSDQDVLFNSTT
GATYSIFDGNEGIQVDGDNIEVSGNTFVYADPSCGSMPMLRTTFDVTKKVASAKMYVTAM
GIYEMYINGQRMGDDWFNPADSQYRDTLCYHAYDVTDMLSEGTNAIGAILSGGWYTGYMT
FSPGNYNFFGDDPALLSKLVITYEDGTEDVIVSDDDTWQVYNNGPIEYSSFFQGERYNAE
KEDSIEGWSTSDYDTTDWETPDVISSRDWIDFDIVSRYDVPIHVLENFTANRVLETHSED
GTTYTYDMGVAMVGVPSITIPKGWLKEGDTVILRYGEDIYPGNEDSQNTNDYYTGLYGEN
GTYHANVAGRVLHDTYRAALATDFYTASAEDENKDVTIQPSLTYRGYRYIQITIPSSTEA
LPTENVQGLVLSSVQELIGTYEATTTDDTITNYVNQLFSNIQRSQVGNFMSIPTDCPQRN
ERMGWTGDAQAFSRTATYNADVENFFRQWMVALRDDQADNGGIGSTVPTYTTSTDVEFAD
GTTWAAAVCMVPWQLYTQYGDTQIIRENFDTMKAWLDGMDSFDFEANGKTYTGLSGKTTG
LADWLSIDGNTTSDIVNNAIYIYMMEVTAIMADEIGETEYAQTLRDRHDLAKQEWNEVYV
DSETGMTQNADGEIIDSQTSYATPLNFNCFNDENKEFAAKRLAELAADPNQSNGGNGLVT
ASSLGQDGGDPIDCPAYSITTGFSGTPNILPALSRNGNSETAYNMITCTDYASWLYPVTL
GATTAWERWNSYELAFEDGGNSAMNSFNHFALGSVGSWMYEYQLGITTDYADSEGGYQNF
VLQPQIGSMYTSLTGSYNSNYGEIKSSWTADNGELLSYSATVPANTSATLYLPISEDQAN
VTTVPEGAEFVEMTEHNGITCAVYTLESGSYEFTVGA

Enzyme Prediction     

No EC number prediction in MGYG000000002_00014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	597	1192	2.5e-130	0.9940476190476191
CBM67	396	565	5e-28	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.31e-95	754	1122	13	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.65e-48	408	558	1	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	9.84e-13	1136	1193	8	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.13e-12	602	732	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25035.1	0.0	37	1235	21	1226
QGH33563.1	1.78e-293	2	1233	5	1182
QGH37059.1	7.12e-258	10	1233	8	1180
AOZ98905.1	1.52e-245	38	1233	24	1177
QOG04730.1	8.54e-239	38	1231	40	1191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.89e-121	50	1235	17	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	8.05e-91	401	1193	135	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.17e-77	398	1193	177	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	7.89e-121	50	1235	17	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.80e-108	400	1199	177	885	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.02e-96	400	1193	173	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.11e-56	401	1196	188	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000718	0.998055	0.000285	0.000399	0.000258	0.000236

TMHMM  Annotations     

start	end
7	29