CAZyme Information: MGYG000000002_00754

Basic Information

• Species: Blautia_A faecis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A faecis
• CAZyme ID: MGYG000000002_00754
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000000002_2|CGC7	49191.35	4.867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000002	4433109	Isolate	United Kingdom	Europe

• Gene Location: Start: 354717; End: 356015 Strand: +

Full Sequence      

MRHKIEMTADEKMWNRISQIPVVVLVLLSGIDIVRFAILGDRTAFITFSMIAVAFMLVAY
MAWKSRMPFLYLLIAVTAFVLYFNTNFSTSTYYFNWLFLAEAIVATLGGILGTTVMIWKK
IPMGRVAVLPLAAAVLILAGFLGFWKVRYDAGHEAQGQARDELWAVPSKYDEEEPEQAGT
VEEVVYDTRAYATDGRSVKKSAYVYLPYGYSKEKEYNILYLMHGTGDDEKYWLKTNPYNK
TMLDNMIADGDIEPLIVVTPTFYVEDDCADDLDQLTYSFAKELRNDLMPEIESSYSTYAK
SADDKGFSKSRDHRAFAGLSRGAVTMYHSVLCQSLDYFSWFGAFSGSRTDKTAFEDTIQT
GDFAELPIHYLYVASGNLDFALPGQIQDYQALLDIELRLRSGVNTCFDVFPMRYHSMGNW
HLALYNFLQKIF

Enzyme Prediction     

No EC number prediction in MGYG000000002_00754.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	201	430	3.6e-27	0.9383259911894273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.75e-13	145	432	35	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.43e-06	195	346	5	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	8.93e-04	204	428	27	255	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADA67819.1	1.67e-35	135	381	8	266
AEY68182.1	2.89e-35	165	383	406	631
ADL33750.1	3.14e-34	165	432	739	995
AGA59284.1	9.30e-34	174	432	323	595
CBK74914.1	1.35e-33	165	432	350	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GKL_A	2.20e-30	200	432	53	287	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6FJ4_A	1.58e-29	200	432	39	273	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1GKK_A	2.11e-29	200	432	53	287	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1GKK_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],3ZI7_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],3ZI7_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],4BAG_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4BAG_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4H35_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],4H35_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],5FXM_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_AAA Chain AAA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_BBB Chain BBB, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1JJF_A	1.37e-26	190	429	36	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	3.59e-26	190	429	36	255	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51584	3.63e-27	200	432	841	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10478	3.71e-24	190	429	55	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	2.01e-20	191	432	436	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.87e-11	156	432	118	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	7.93e-11	200	377	514	677	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39
43	62
69	86
96	118
123	145