CAZyme Information: MGYG000000002_01479

Basic Information

• Species: Blautia_A faecis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A faecis
• CAZyme ID: MGYG000000002_01479
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000000002_5|CGC1	54311.1	4.8393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000002	4433109	Isolate	United Kingdom	Europe

• Gene Location: Start: 169894; End: 171318 Strand: +

Full Sequence      

MPTDQELIKIVPSCRQIAYQATEFYAFFHFGMNTYTNREWGDGTENPQIFNPTEFDADQW
VTAAQNAGMKGVILTCKHHDGFCLWPTRYTSHSVAASPWKNGRGDVVREVSEACRRHGLK
FGIYLSPWDRNQPCYGSGKEYDDYYLAQLTELLTCYGDIFSVWLDGACGEGPNGKKQVYD
WNRYYECVRKYQPDACICVCGPDIRWCGNEAGDVRKSEWSVVPARTALAESVQERSQQTD
DEEFRMRRITSDMEDLGSRKALEGETDLIWYPAEVNTSIRPGWFYHPEEDDQVKSLEELI
HIYIGAVGGNATFLLNIPPMPNGLLHKNDVKRLEEFGSWKKKSFAHNLMSTAHVFSENED
PAHPASNLTEDTLEAWYQPESSELPVEITICLDDSYNLGYLVLKETVCYSQRVEKYEVFV
KEGEIWNSIYTGTVIGYQKIIPVKGKKAREMKIVLHDFRVLPLLTFIGIYPENT

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	18	342	5.5e-87	0.8526011560693642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	3.42e-66	12	470	11	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	4.25e-46	50	342	79	330	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	6.06e-44	50	342	76	332	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET79943.1	2.77e-202	1	470	1	468
ABX43385.1	6.68e-201	4	470	5	469
QQR31700.1	1.82e-199	4	470	8	445
ASB42413.1	1.82e-199	4	470	8	445
ANU54367.1	1.82e-199	4	470	8	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UES_A	3.47e-162	7	465	14	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	4.57e-160	7	465	14	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	2.79e-159	7	465	16	473	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	5.96e-145	9	470	29	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	8.74e-100	11	474	38	469	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	3.00e-107	11	473	37	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	6.25e-100	11	473	39	479	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	1.56e-09	55	166	105	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
C3YWU0	4.69e-09	49	166	91	214	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q9VTJ4	6.81e-09	55	139	112	195	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000002_01479.