CAZyme Information: MGYG000000005_02841

Basic Information

• Species: Terrisporobacter glycolicus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter glycolicus_A
• CAZyme ID: MGYG000000005_02841
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000000005_4|CGC4	24175.63	9.0555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000005	3930428	Isolate	United Kingdom	Europe

• Gene Location: Start: 296265; End: 296924 Strand: -

Full Sequence      

MINSVDLLKYQLSSSLTGLNKCSCESSSNSFDMVMISLLKAISTTNSQNINININLNNKN
LGKITGLETLNSSQNSNKIQATNKDKSVNERIENAVEKCAKKYGVNESLIKSIIKVESNF
NPNCVSGAGAKGLMQLMPFNCTDLGVKDPFNIEQNIDGGTRHIKEYLDMYGGDEQMALMA
YNGGPGRMASRGVKTINDLYKMPRETQNYVPKVMKYYKG

Enzyme Prediction     

No EC number prediction in MGYG000000005_02841.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	107	218	1.4e-29	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.00e-46	107	218	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	4.98e-39	96	218	8	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.27e-33	95	217	9	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.24e-30	67	217	118	280	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	4.00e-30	100	187	5	98	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU73976.1	4.78e-78	11	219	15	222
AVB48356.1	9.62e-78	11	219	15	222
QGS40145.1	9.62e-78	11	219	15	222
AUA35620.1	9.62e-78	11	219	15	222
AYC95974.1	9.62e-78	11	219	15	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	6.58e-08	107	216	468	594	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
6FBT_A	2.90e-07	100	216	457	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.94e-07	100	216	486	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4C5F_A	3.07e-07	96	186	178	286	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
6FC4_A	7.08e-07	100	216	458	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.04e-34	60	217	25	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.07e-21	96	217	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.07e-21	96	217	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.79e-15	103	215	18	117	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8GJ50	1.06e-08	96	213	195	348	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000005_02841.