CAZyme Information: MGYG000000005_02937

Basic Information

• Species: Terrisporobacter glycolicus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter glycolicus_A
• CAZyme ID: MGYG000000005_02937
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	MGYG000000005_4|CGC5	73598.7	6.7364

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000005	3930428	Isolate	United Kingdom	Europe

• Gene Location: Start: 395044; End: 396918 Strand: -

Full Sequence      

MDIKRVFNTVKYMNSRQIIYRFRYEISKRYCRKINSKGCFTINESYKFRNKNYIPQNEDI
VSDADKILSNEFTFLNELTYQFKEEIDWKINPFNYRLWNFNLNYFDFLEVLYDSYEIKND
IKYLKKGVELIFQWIKKNEEYDVNTWDPYVVSKRLFNFINFIADIKDKYNVDKLDEINYS
IYTQAEYLNKNIEYYLDANHVIMDGKGLVFSGIYFNDSNFLEKGISILENEYKRQVLADG
GHYERSPSYQVEVLSHYVECYMLLVKNGMNDKGDLFIKPIGKMATYLEAIIMPNGEIPLL
NDSSLDYPFNADDLLKICSVILNKKMFHSCILSNYVLSLLDSHDLKKYNELIGRDKKHNI
KNIAMKESGYYIIKDSINDEKIYILFDCGDGGPDYNLGHTHADSLNIVISLGEKELIMDS
GTFTYKIGNDRNHYRSTLAHNTITIDNKNSSDIWAGFRVAKRAKSFIGKYEEDEAYIYIR
AYHDGYCKTLRKDKIIHTRELVYVYGKGIFIIDTLSGGINNSHSAVLNYNIAKEVFDKEE
QKLTTDRNSLYLDISREYEVEHSKYSSEFSIERECMSVRSKWNFSKENSIVTSIMINDNK
LELDMDRNNIKIKQNKIKIIQINR

Enzyme Prediction     

No EC number prediction in MGYG000000005_02937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	368	514	7.4e-32	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	5.19e-37	364	549	8	185	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16889	Hepar_II_III_N	1.73e-22	80	303	77	317	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
COG5360	COG5360	2.14e-10	228	502	220	456	Uncharacterized conserved protein, heparinase superfamily [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKI27518.1	1.32e-152	3	603	7	617
BBG65146.1	1.94e-68	1	503	5	444
QOR62629.1	7.94e-67	5	516	6	455
AZS31715.1	1.24e-62	6	579	10	508
QKE33117.1	2.99e-62	5	524	9	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JMD_A	9.43e-19	79	449	95	474	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
4MMH_A	4.95e-18	64	449	75	454	Crystalstructure of heparan sulfate lyase HepC from Pedobacter heparinus [Pedobacter heparinus]
4MMI_A	4.95e-18	64	449	75	454	Crystalstructure of heparan sulfate lyase HepC mutant from Pedobacter heparinus [Pedobacter heparinus]
5JMF_A	3.34e-16	79	449	95	474	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59289	2.79e-17	64	449	99	478	Heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepC PE=1 SV=1
C7EXL6	1.41e-15	64	544	89	562	Heparin-sulfate lyase OS=Bacteroides stercoris OX=46506 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000005_02937.