CAZyme Information: MGYG000000006_01559

Basic Information

• Species: Staphylococcus xylosus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus
• CAZyme ID: MGYG000000006_01559
• CAZy Family: GT2
• CAZyme Description: 4,4'-diaponeurosporenoate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41502.33	9.6687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000006	2822527	Isolate	United Kingdom	Europe

• Gene Location: Start: 63401; End: 64504 Strand: +

Full Sequence      

MILYIIAIVLTILSLISGMCMYARRAVINNSGKERGQTAVSVIVPARNEAENLPKLLNSI
SKEQEIEVIVMDDGSTDKTQAVARYYGASVYIVENDTTWRGKSHACWQGSKYATHDLLMF
VDADVQFTGDDSIQRIANQYHLQDGKGLLSIQPYHKIKKLYENVSAIFNLMTVVGMNKFS
ITKSANNEQGAFGPVLVTNKQDYKLTQGHLKAKNQIIEGFAISKAYNEQGLPVSLHEGQG
VVNFRMYSQGYKVLLEGWSKHFALGSQVTKKSTLTFVFLWLFGSLTTVLAIIFSINLGSL
YILLAITLYFIYAIQFHIFIRRTGNFNIVASLCHPLLFICFVVIFFKSWLDINVFKRIYW
KGRRIDL

Enzyme Prediction     

No EC number prediction in MGYG000000006_01559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	41	167	1.9e-22	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	3.42e-19	42	150	1	112	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.90e-18	41	168	1	130	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04192	GT_2_like_e	9.06e-18	42	192	1	173	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	1.76e-17	42	146	1	108	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd04179	DPM_DPG-synthase_like	3.22e-17	42	126	1	91	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ10347.1	1.54e-249	1	367	1	367
QSN67636.1	1.54e-249	1	367	1	367
CCM44203.1	2.96e-249	21	367	1	347
QKQ09233.1	6.26e-249	1	367	1	367
QZZ03598.1	6.26e-249	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	5.89e-07	40	130	15	108	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7A3E0	1.12e-101	9	367	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=crtQ PE=1 SV=1
Q99R74	1.12e-101	9	367	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=crtQ PE=3 SV=1
Q53590	2.24e-101	9	367	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain Newman) OX=426430 GN=crtQ PE=3 SV=2
Q8NUQ4	2.24e-101	9	367	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=crtQ PE=3 SV=1
Q5HCY7	2.24e-101	9	367	10	371	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.986973	0.012141	0.000412	0.000117	0.000060	0.000322

TMHMM  Annotations     

start	end
4	23
276	293
297	319
324	346