CAZyme Information: MGYG000000006_01849

Basic Information

• Species: Staphylococcus xylosus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus
• CAZyme ID: MGYG000000006_01849
• CAZy Family: GH23
• CAZyme Description: putative transglycosylase SceD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000000006_13|CGC1	24232.45	3.6141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000006	2822527	Isolate	United Kingdom	Europe

• Gene Location: Start: 28070; End: 28765 Strand: -

Full Sequence      

MKKTVIASTLAVGLGVTGFAAGNSADAAEQGVDKAQLAQQALTNPESLNEAPVQEGAYDI
NFTYNNTDFNFSSDGENFSWSYGEGSSEESNTPVEQTTNNNVQEEQAQTTTEQPAQEAAP
QEETTQQPQQEATSQPSTTSNESSSNEASEGSSGVNAHLQQIAQRESGGDIHATNPSSGA
SGKFQFLQSTWDSVAPAQYQGQPAGNAPEAVQDAAAQKLYDEVGASQWVTA

Enzyme Prediction     

No EC number prediction in MGYG000000006_01849.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	2.09e-19	157	230	1	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam06737	Transglycosylas	2.12e-18	155	231	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd00442	Lyz-like	0.010	162	217	5	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW88688.1	1.23e-116	1	231	1	231
CEF18258.1	1.23e-116	1	231	1	231
AID42253.1	1.23e-116	1	231	1	231
AID01956.1	2.61e-111	1	231	1	231
ARD75041.1	2.61e-111	1	231	1	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49Z43	8.28e-77	1	231	1	238	Probable transglycosylase SceD 3 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sceD3 PE=3 SV=1
Q4A0X5	1.66e-76	1	231	1	238	Probable transglycosylase SceD 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sceD1 PE=3 SV=1
Q4A0X4	8.17e-67	1	231	1	249	Probable transglycosylase SceD 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sceD2 PE=3 SV=1
Q5HMC6	7.59e-58	1	231	1	219	Probable transglycosylase SceD OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sceD PE=3 SV=1
Q8CMK7	7.59e-58	1	231	1	219	Probable transglycosylase SceD OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sceD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000440	0.998674	0.000215	0.000262	0.000206	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000006_01849.