CAZyme Information: MGYG000000006_02314

Basic Information

• Species: Staphylococcus xylosus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus
• CAZyme ID: MGYG000000006_02314
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		48416.18	9.7873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000006	2822527	Isolate	United Kingdom	Europe

• Gene Location: Start: 58765; End: 60072 Strand: -

Full Sequence      

MKYRLSLSLIVATSLVLSTTVAYAQEDSGKQTTEKDKKENTSKPIDFDKAQKMSPQALKD
QLTPEDLRLHNKVAEHNSNSVEMRSFANRSYQDVNTYIANNNIKPAQIVQDSRINNLPKY
NYKSGKFIGVVIHETANPNSTIEGEVNYMYNNYQSAFVHAYASSDKIIQTAPSNYLAWGA
GANANPYFYQIELTRSNTFDGFAKSVNNQAYLAAKMLKQNGLAPSLADNNQGTGTIISHN
AISQYWGGTDHTDPVGYFNQWGYNMDQFYSLVQKHYKELNGGGNDDVITGSTYKVAKGDT
LYSISRRSGVAIDDIKKWNNLSNNTLSVGQILKLKAPSNSGEITGDTHKVVSGDTLYNIS
KRSHVSVENIKKWNNLKNDSISKGQTLYLVKTYTVKKGDTLYSIAKNQKTTVDKIKSDNK
LDSNSIKVGQILKIK

Enzyme Prediction     

No EC number prediction in MGYG000000006_02314.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	4.46e-29	292	435	407	592	1,4-beta-N-acetylmuramoylhydrolase.
smart00644	Ami_2	3.09e-23	129	254	5	126	Ami_2 domain.
COG5632	CwlA	4.16e-21	122	311	19	199	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
cd06583	PGRP	4.00e-19	129	257	4	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
PRK10783	mltD	1.94e-18	289	394	342	453	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARD75984.1	6.08e-279	1	394	1	394
AID43831.1	3.51e-278	1	394	1	394
CEF19930.1	4.99e-278	1	394	1	394
AID02874.1	7.08e-278	1	394	1	394
QDW90218.1	7.08e-278	1	394	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KNK_A	4.97e-52	94	276	29	211	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNK_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_A Chain A, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_B Chain B, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_C Chain C, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325],4KNL_D Chain D, Bifunctional autolysin [Staphylococcus aureus subsp. aureus NCTC 8325]
3LAT_A	1.04e-45	94	276	20	202	Crystalstructure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis],3LAT_B Crystal structure of Staphylococcus peptidoglycan hydrolase AmiE [Staphylococcus epidermidis]
4UZ2_A	2.69e-06	291	334	3	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33983	3.24e-53	87	303	78	299	Protein Ami OS=Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) OX=1334565 GN=ami PE=3 SV=1
Q6GAG0	6.98e-47	94	390	225	532	Bifunctional autolysin OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=atl PE=3 SV=1
Q2FZK7	1.73e-46	94	276	225	407	Bifunctional autolysin OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=atl PE=1 SV=1
Q931U5	2.34e-46	94	276	217	399	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2
Q99V41	2.34e-46	94	276	217	399	Bifunctional autolysin OS=Staphylococcus aureus (strain N315) OX=158879 GN=atl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002116	0.996247	0.000535	0.000479	0.000329	0.000259

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000006_02314.