CAZyme Information: MGYG000000006_02333

Basic Information

• Species: Staphylococcus xylosus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus
• CAZyme ID: MGYG000000006_02333
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000000006_19|CGC2	34546.06	9.8794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000006	2822527	Isolate	United Kingdom	Europe

• Gene Location: Start: 20730; End: 21716 Strand: -

Full Sequence      

MRKKIIATVIGTSALAAVSSTNADAATTYKVKSGDSLWSIANKFNTSVDKLKSLNNLSSN
VIFPNQSLKVSGTSSSNTSSNTTTGTTYTVKSGDTLSDIAARYGTTYQKIMSLNGLSNFN
IYPGQKLKVSGTASTGGSNTSGNTSSGSTTTYTVKSGDSLSAIAARYGTTYQKIMSLNGL
TNFNIYPGQKLKVSGSASTGGSGSTGSSGSSGYYTPVFNHSNLYDWGQCTWHVFNKRAQI
GKGISTYWWNANSWDTGAAADGYTVDYNATVGSILQSDLGYYGHVAFVESVNSNGSITVS
EMNYSAAPGTVTYRTIPASQVKSYKYIH

Enzyme Prediction     

No EC number prediction in MGYG000000006_02333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	88	129	7.1e-18	0.95
CBM50	152	193	1.1e-17	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	2.55e-37	213	328	57	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.01e-27	12	193	394	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	3.30e-27	19	193	323	523	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	2.16e-22	216	327	497	616	amidase domain-containing protein.
PRK10783	mltD	1.25e-20	6	127	327	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AID43733.1	2.47e-208	1	328	1	328
QDW90134.1	2.47e-208	1	328	1	328
AID02970.1	1.00e-207	1	328	1	328
ARD76072.1	5.80e-207	1	328	1	328
CEF19837.1	8.23e-207	1	328	1	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	4.79e-33	221	328	49	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	5.44e-33	217	328	4	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	1.18e-14	221	327	245	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	9.52e-09	87	129	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	5.59e-07	87	129	4	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	1.84e-183	1	328	1	327	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q8CMN2	2.19e-146	1	328	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	2.19e-146	1	328	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q7A7E0	9.74e-143	1	328	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=sle1 PE=1 SV=1
Q5HIL2	9.74e-143	1	328	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999095	0.000160	0.000185	0.000166	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000006_02333.