CAZyme Information: MGYG000000006_02586

Basic Information

• Species: Staphylococcus xylosus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus
• CAZyme ID: MGYG000000006_02586
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000000006_23|CGC1	64476.74	5.066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000006	2822527	Isolate	United Kingdom	Europe

• Gene Location: Start: 46034; End: 47758 Strand: +

Full Sequence      

MVKVNLKTSPYNLDDTQIAWVEETLKDLSNEEKIGQLFFNLFSLEDGKKFHDADLSNKEV
LERYHIGGARYEGGNKVDVQRLLNDLQQNTKVPVLVAANCDSGGNGACKDGTYIASAAQC
EAAQDTKVAYNAGLVSAREASALGVHINFDPCVDILKNWRNTIVNTRSYGTEAQTVIKYS
SAFIDGFNSEHDMITCIKHFPGDGTEERDQHLVLGVNELSTEEWDDSFRKVYQHHIDRGV
QMIMAGHIAQPAYSKKLNSNLEDKDILPATLSKELITDLLKDDMHFNGLVVTDASHMLGM
TAAMRREDYVPLSIAAGCDMFLFFNDLEEDYQFMLNGYNNGVITDERLDDAVRRILGLKA
QLNLHKKQVDGTIIRAKEDLQVIGCQEHLDMRAEAADLGITLVKNTLDQLPIRPETHKNI
RLYVIEGEKDGIYKSANNVPEDIIKELESRGFNVTLNDGSTRVKGKTLSYREDVDAALVF
ANIIGYAAENNYRIKWGTAMSNEIPWYVHEVPTVFVSLNFTTHLHDATMVKAYINAYHSN
PESIKQTVDKIMGLSTFKGSYNDLVWTDKWQAKL

Enzyme Prediction     

No EC number prediction in MGYG000000006_02586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	322	1.2e-47	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.20e-60	28	418	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.60e-56	31	358	3	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.68e-22	113	326	83	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	8.79e-19	8	425	26	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AID41876.1	0.0	1	574	1	574
CEF17873.1	0.0	1	574	1	574
QDW88321.1	0.0	1	574	1	574
ARD75402.1	0.0	1	574	1	574
AID02322.1	0.0	1	574	1	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.19e-112	6	574	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	3.20e-42	28	445	42	477	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.15e-41	28	445	16	451	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.59e-41	28	445	46	481	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.17e-31	26	409	9	386	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	7.60e-118	4	574	2	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.75e-41	28	445	42	477	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.30e-21	59	413	57	426	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q9KU37	5.11e-21	51	336	11	285	Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=nagZ PE=1 SV=1
C3LSU7	5.11e-21	51	336	11	285	Beta-hexosaminidase OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000006_02586.