CAZyme Information: MGYG000000007_01224

Basic Information

• Species: Lactobacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus intestinalis
• CAZyme ID: MGYG000000007_01224
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1008	MGYG000000007_5|CGC1	114552.84	6.16

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000007	2016167	Isolate	United Kingdom	Europe

• Gene Location: Start: 74753; End: 77779 Strand: -

Full Sequence      

MTQDTQMNRHQLGQLIGANKRDHYYELHYATGEVARLYILSDGIFRYFLDPDNNFDESHT
SFVDLSKFDNHLFEKSSPRATSDSLIIQTGNYQLIFQQKPAIMSVFDETLHHTRLVQASP
LEIGNTDSVEILHQNKNEFYFGGGLQNGYFSHKGKEIEIKRDQIKGKGGVLTQVPFFWSN
AGFGELRNTTTLGHYDFGSKQNDVTILSHNTRVFDNFYIIGNSPSDILNKYYILTGRPLM
PPKYAFKLGYAGNFLSTLWQPSEAKQRNAEMYEDETYYVPTDNPENASGKASLNGEDQYQ
FSARAMLDRFKKERFDLGWFIPNYGVEKVDPQAISSFNNYANSQKVDPGIWTTESDNIPN
NSSFVATNTSDAQLLNKDKQILRENLKKKRPFILSNTGIAGSQRNSALAFGDIGGNWENI
ATQVAGFLGSNLSGEPILGSAVDGTAGGGNAQISIRDFEWKAFTPLLFSIDNQGKFSKTP
FAYNAKMTRINRAYLNLREQLKHYLYTLTYQAQLGEPIMRALFIEFPHEQVNYTSQVGHE
FMLGPNLLIAPITNGREDSNGNSRKDNLYLPNHRTMWVDLFTGNKYLGGRVFNKLSYPIW
HLPVFVRGGSIFELGNRNYLLYPQGKSEITFYDDNGFNDFSHNHTETHLTSNLESSKLKV
TIDPVQGSYTGMETNNTTNLNIMCDTYPDRVTVRINDQEINMQEYGTVDTFGHAKEGYFY
NTNFSWTPQFDQYQDPKHKQTALQIKLANRDVTDSKIEIEIQNFNYGNETLVHAITDSLL
RSPKQPIIDPEKITAHSLTVSWPQLTDKVQIEVNGILYDGIDGDSFTFHELEPHTRYIMR
LRYVSGNKVSEWSDPFGAITKRSALDYAIKNVQVNSNLESDAHHPLNYLTDLKLASEWET
TESVSEDNPLTLTFTFAQPEKLSRMTYVPRNIDHKSDPIEVGVEISTDGENFTPYGERLT
WKADSKNKVVGLRDVTAKAIRLTVYKSSGDKVAGKEVLFFRNKNSIND

Enzyme Prediction     

No EC number prediction in MGYG000000007_01224.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	366	611	1.9e-54	0.5480093676814989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	1.12e-67	234	583	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	1.04e-53	44	682	64	753	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.48e-49	217	611	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	3.19e-32	381	636	204	465	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	1.47e-18	387	670	389	669	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD72701.1	0.0	1	1003	1	1002
QFG50650.1	0.0	1	1003	1	1002
BAQ56552.1	0.0	1	1003	1	1002
QGV05184.1	0.0	1	1003	1	1002
ATO53041.1	0.0	1	1003	1	1002

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	2.72e-167	12	861	37	958	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7Q_A	5.37e-167	12	861	37	958	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7R_A	5.37e-167	12	861	37	958	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR8_A	3.08e-26	30	662	48	755	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
6JR6_A	4.06e-26	30	662	48	755	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	6.39e-29	2	636	17	711	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B9F676	2.42e-22	117	617	251	782	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q8TET4	1.32e-19	213	614	330	781	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3
Q9BE70	4.39e-19	157	611	106	633	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2
Q8BVW0	8.84e-19	388	611	547	762	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000007_01224.