CAZyme Information: MGYG000000007_01317

Basic Information

• Species: Lactobacillus intestinalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus intestinalis
• CAZyme ID: MGYG000000007_01317
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase Mel36A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732	MGYG000000007_6|CGC1	84086.35	5.7051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000007	2016167	Isolate	United Kingdom	Europe

• Gene Location: Start: 26323; End: 28521 Strand: +

Full Sequence      

MNQLINYDEKNRVFHLHNDQISYLLAVEDGKTLAHLYFGKAIKNYHGQLRYPRVDRGFSG
NLPGSLDRTFSRDSLPKEYSSAGEMDYHTPAAVIRQSDGSNALFLTYEGYKIVDGKPDLE
GLPHSFVESKDEAQTLIVTLIDEKSKVKFELSYTIYRNRPVITRSVKVINDGDKKVNIEK
VASMQIDFVDRDFESITLPGAHAHERRVERSEINQGIHVYSSHRGTSSHQMNPFMALVDP
DTTEFVGDAYGFAFVYSGNHKFEVERDQFAQTHVNIGINDFNFNWELRPTASFQTPEVLM
VYSDQGINKMSQAFHSLIHERVIRSKYKNQVRPILVNNWEATYFDFDEKKLHPIVDDAKE
MGIEMFVLDDGWFGHRDDDNSSLGDWSVFEKKFPNGLDHFADYVHQQGLKFGLWFEPEMI
SMDSDLYKKHPDYLMHVPGRLPSPSRNQYVLDLGRKEVRDNIFDQMNNILSSGKIDYIKW
DMNRHLSDIYEADLPSARQGEVYHRYVLGLYDLLERVVDTYPDLLIEGCSGGGGRFDAGM
AYYTPQIWASDDSDAIDRLSIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFNTRGVVGM
WGDLGYELDLTKMSKEDRQEVKNQVAEYKKIRQVTQYGTFYRLKNAQISNQCAWETVSPD
KNEVVLSVVKVMASAQPYLTKTKLVGLDPKKHYEDQVSHEVYGGDELMNLGIYDPVEHGD
FMAHLYHFKAIN

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	13	713	3.8e-282	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	0.0	292	638	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	0.0	11	731	1	687	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	1.90e-149	332	630	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.87e-116	33	287	3	255	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	3.10e-25	651	728	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL67607.1	0.0	1	732	1	732
AZZ66824.1	0.0	1	732	1	732
QXL47855.1	0.0	1	732	1	732
AAS08244.1	0.0	1	732	1	732
AEB92606.1	0.0	1	732	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN2_A	0.0	4	732	5	732	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
2XN0_A	0.0	4	732	5	732	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
4FNQ_A	1.09e-255	5	731	3	727	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.32e-252	5	731	3	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	2.15e-250	5	731	3	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	0.0	4	732	5	732	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	0.0	4	731	3	730	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q9ALJ4	1.27e-251	5	731	3	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	9.86e-220	5	731	3	720	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	1.03e-183	10	728	6	717	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000007_01317.