CAZyme Information: MGYG000000008_01171

Basic Information

• Species: Lactobacillus johnsonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus johnsonii
• CAZyme ID: MGYG000000008_01171
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
149	MGYG000000008_10|CGC2	17274.4	10.1942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000008	1971706	Isolate	United Kingdom	Europe

• Gene Location: Start: 18754; End: 19203 Strand: -

Full Sequence      

MKVCLVGSSGGHLTHLYMLKPFWQNKDRFWVTFDKEDARSKLKGEKMYGCHYPTNRNLKN
LIRNTFLAIKVLRKERPDVIISSGAAVAVPFFYIGKLMGAKTVYIEVFDRYDKPTITGKL
VYPITDKFIVEWEEMKKVYPKAINLGSIF

Enzyme Prediction     

No EC number prediction in MGYG000000008_01171.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	1.99e-21	3	146	1	169	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	1.19e-12	1	142	1	154	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	3.35e-06	56	142	69	152	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	0.001	52	103	64	118	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH66437.1	1.47e-109	1	149	1	149
ABM21401.1	1.47e-109	1	149	1	149
ASY53473.1	1.47e-109	1	149	1	149
ABJ60521.1	1.47e-109	1	149	1	149
AEB93451.1	1.21e-108	1	149	1	149

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q96F25	8.14e-10	62	148	123	215	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1
Q5A5N6	1.61e-09	66	148	131	218	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG14 PE=3 SV=1
Q6AY85	1.09e-08	66	148	127	215	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus OX=10116 GN=Alg14 PE=2 SV=1
Q6CF02	2.08e-08	67	148	128	215	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG14 PE=3 SV=1
Q6BMD0	4.53e-08	24	148	111	231	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG14 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000008_01171.