CAZyme Information: MGYG000000009_00852

Basic Information

• Species: Ligilactobacillus murinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus murinus
• CAZyme ID: MGYG000000009_00852
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000000009_12|CGC1	43230.21	9.3306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000009	2219792	Isolate	United Kingdom	Europe

• Gene Location: Start: 39184; End: 40359 Strand: +

Full Sequence      

MNKKKLLGVVALATLFLSLVAPTAQAARTDMVDVSNHNGYMTVGNFTAMRDQYGVKSVVT
KISEGTYYHDYTAKNNISTAQQSGLYINGYHFARWSSVAGARAEANYAVAMAKADGLPIN
AVLVADVEGEQQQRTPLNINNLAVMEFKRIVEAAGYRYDIYTGQGWRDTIVSVPKGTGWI
AHYPWDTSWDRYTNHHAWQWTSTMKFNGSYGNFDASQLYDDFYTGGQNKNAVISNSNTAD
VDNQKEAKQEATSQPQTSSKDEDYAQIGMFTANTTLNVRTAPSTSAKIVASYAPSEKLTY
DHVYIKGGYVWARYMSYSGSYHYVAMGVMGGQEYGARRAYSATVQTRSYTVKSGDSLSVI
ARKLGTTVSHLQSMNGIRNANLIYPGQTLKY

Enzyme Prediction     

No EC number prediction in MGYG000000009_00852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	32	208	1.2e-30	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	5.61e-50	30	219	2	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
cd00599	GH25_muramidase	3.98e-20	31	214	2	182	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.83e-20	32	208	1	179	Glycosyl hydrolases family 25.
cd06415	GH25_Cpl1-like	1.43e-16	32	214	4	194	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
cd06525	GH25_Lyc-like	1.20e-15	32	214	3	180	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA90488.1	4.47e-233	3	391	2	389
QLL78829.1	1.09e-141	11	389	4	368
QLL78793.1	4.40e-141	11	389	4	368
QBK08429.1	1.02e-139	23	389	4	358
QLL78787.1	3.01e-139	12	389	3	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A6S_A	2.45e-07	31	222	24	205	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
5D74_A	2.97e-06	257	335	185	266	Thecrystal structure of Ly7917 [Streptococcus phage phi7917],5D74_B The crystal structure of Ly7917 [Streptococcus phage phi7917],5D76_A The crystal structure of Ly7917 with the hydrolyzing product of MDP [Streptococcus phage phi7917],5D76_B The crystal structure of Ly7917 with the hydrolyzing product of MDP [Streptococcus phage phi7917]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L3C1	2.11e-07	328	390	71	130	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q49UX4	2.79e-07	348	390	151	192	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q6GHI8	4.51e-07	330	390	158	218	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lytN PE=3 SV=2
Q9ZNI1	7.98e-07	345	390	173	218	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=lytN PE=2 SV=2
Q6G9W6	7.98e-07	345	390	173	218	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.998965	0.000201	0.000195	0.000188	0.000171

TMHMM  Annotations     

start	end
7	26