CAZyme Information: MGYG000000010_01075

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01075
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000010_7|CGC3	28210.67	4.6257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 50909; End: 51715 Strand: +

Full Sequence      

MKKFAFAVTAVSGVAAIAAHNDAEASTQHTVKNGESLWAIADQYGVSVDQLKSSNNISGN
MIFPGQVITVNGSSSAGGSGSQETATSGSTYTVKNGDSLEVIAQKHGVSVDQLMKSNNLQ
GYIIYPGQTLKIAGGSGSDTTAPSDNTPPSQTGGNQTFNDQNLYDWGQCTYYVFDRRGQA
GSAISTYWGDAKYWAGAAQADGFRVDNTPAVGSIMQSSAGQYGHVSYVESINADGSLLVS
ETNYNTPPGVTDYRTIPASEVYNYSYIH

Enzyme Prediction     

No EC number prediction in MGYG000000010_01075.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	1.90e-37	112	268	13	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	1.33e-21	29	159	333	478	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	5.18e-21	164	267	508	616	amidase domain-containing protein.
PRK06347	PRK06347	7.21e-21	29	152	408	546	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	9.91e-19	19	130	336	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU11861.1	2.23e-190	1	268	1	268
QQT14737.1	1.71e-174	1	268	1	270
QRO83975.1	1.71e-174	1	268	1	270
QQY19964.1	1.71e-174	1	268	1	270
QTN11230.1	1.71e-174	1	268	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2LRJ_A	1.83e-33	162	268	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
2K3A_A	6.23e-33	138	268	30	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
5T1Q_A	1.70e-16	160	267	244	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
2MKX_A	1.56e-07	26	70	4	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
4UZ2_A	3.04e-07	90	132	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G0D4	1.37e-103	1	268	1	265	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q5HIL2	1.71e-77	2	268	3	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1
Q6GC24	1.71e-77	2	268	3	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q7A1T4	1.71e-77	2	268	3	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1
Q2FJH7	1.71e-77	2	268	3	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain USA300) OX=367830 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.998938	0.000182	0.000201	0.000184	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000010_01075.