CAZyme Information: MGYG000000010_01832

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01832
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1080	MGYG000000010_17|CGC1	128282.97	6.7965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 51605; End: 54847 Strand: -

Full Sequence      

MKSLLLYKQKRGYVDMKTLNIYQVGELLTLEFDQTIDNIKNVYVKNEFDEISFEQTGIKN
KFVINLFEILNVFDKYDRETIFFLLEKTDGITQSIQKVNVKKYDYEIYNFETVVNEEATL
TPYLTKNGVLQFTKKPQLPLSTYFARRHIDKVTINNKRAFIKGKFSLQNSTLKEAKLLIT
SRLSENVIEVPLNTTVFNVYKSLNSISYDFEVDIINDLKQFLLNDFDSEDIIDLFLEIKV
QEFRESIDVKLGNPRILVERLSKGEISIEQNDKIKTAVPYFTMKGRNLSFRINEYDIEDY
NAYKKLMHDYPTLIKNAFNKNKIWIVGEKSYKAQDNGYHFFKYMRTQHPNEEVYYVIDKD
SEERKNVEPFGNVIYFKSKEHFELMVKADIICSTHHTELLFPSHEANYIKKIRAKRIFLQ
HGVLGTKNLTQINGKQLKDFNVDMFITSSPREKQIVNRDLLFDDYQIKSTGLSRFDELFK
DNVTQKNQILIIPTWRDWITNINSLLESDYLQYYNDLLNNPEWEQITNKQNIDIIFCLHP
NMQAFVDLFNIPDYITIIRQGEVDVQLLIKESKLMITDYSSVAFDFSFLEKPVIYYPFDR
DRFIGELPSHLDLDEELPGRIYDEAEDVIAATKEYIDNNFVNEASIIKKANNFIEHKDTD
NSKRIYQAAKDFKRKNKIKDILKYDILSQHIFMRFRKNKRYFDAMSYMNKFLVKFAKVDE
KLIVIESNLGKQVTDSPKMIYDQIKQLDKGYKIVWVTNKIYPFDDENVITVKRLSPDYYR
YLSIAKYWINNQNFPYYIKKKKQTVFIQTWHGTPLKKMLNDVDEFKGRDEGYIDRINESV
SKWDYLVSPSPYATECFKSAFRFNKEMLEVGYPRNDIFYQDEKLIEEQRKTIKRKLSIPK
DKKVILYAPTFRDDEVSAAKKHLINLKLDLHQMKERLGDEYVLLLRPHIIISNKIIIDKS
LEDFIYNVADYEEISDLYLISDICITDYSSVMFDFANTRKPLLFFTYDLDHYKDNLRGFY
MNFEDEAPGPLLKDNETLIDSIKNIETINKSYQEKYDKFYDKFCSFEKGNAAKRIVEKLF

Enzyme Prediction     

No EC number prediction in MGYG000000010_01832.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	8.02e-114	718	1080	2	359	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.89e-81	711	1080	17	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam04464	Glyphos_transf	7.56e-33	318	668	2	357	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
pfam18674	TarS_C1	6.12e-28	146	292	1	148	TarS beta-glycosyltransferase C-terminal domain 1. Beta-glycosyltransferase TarS is an enzyme responsible for the glycosylation of wall teichoic acid polymers of the S. aureus cell wall, a process that has been shown to be specifically responsible for methicillin resistance in MRSA. It contains a trimerization domain composed of tandem carbohydrate binding motifs.The two C-terminally localized regions composed of a series of beta-sheets participate in an extensive trimerization interface and they assume an immunoglobulin-like fold. It is suggested that both carbohydrate binding domains may be involved in polyRboP binding, however unlike pullulanase, the CBMs of TarS are involved in the formation of an extensive trimerization interface.
COG1887	TagB	1.84e-25	318	675	23	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYG90226.1	1.32e-112	710	1080	360	726
ADP34069.1	1.32e-112	710	1080	360	726
AMR61243.1	1.32e-112	710	1080	360	726
ASS72817.1	1.32e-112	710	1080	360	726
AIK46629.1	1.32e-112	710	1080	360	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.00e-90	608	1075	263	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	9.59e-90	608	1075	263	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.52e-89	608	1075	263	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	1.66e-96	719	1079	30	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	4.92e-94	718	1080	379	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	4.58e-90	608	1075	263	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	9.90e-87	719	1080	26	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P46918	4.93e-34	304	668	518	889	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999180	0.000797	0.000040	0.000003	0.000001	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000010_01832.