CAZyme Information: MGYG000000010_01833

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01833
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000000010_17|CGC1	58747.26	9.1255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 54804; End: 56285 Strand: -

Full Sequence      

MDKKFFLMTEESFRETIAFYNKNEINQNVNIKLNTYLDKVLNPLFPYKYDFILNNERQLI
RLINKMEYQPPMKSIFKYLEIKSMIHGKFYFSYLFSRIRKLLSSLKSNYYSAMIIPQKLE
NIIIYESFSGKAFSDSPKKLYQYLSSQLKGYEHIVVVDDEKLKNELNKLNIQTVNKNTKE
YFKLYNKAKIWISNIRLSPQIEKKPNQIYIQTWHGTPLKKLANDQNVISIPEVTLEEYLY
GFTKETERWDYLISPSEIATTRFKSAFKLKDNQILTLGYPRNDDLINFNHKNYINELKKK
HNIPSDKKIILYAPTWRDNDREEIGRYNFNLKLDLEDFNSKLRGEYILIIRAHYLVSENL
ELDKYSNIYDLSSANDINELFLMSDILITDYSSVYFDYANLKRPILFFAYDKDEYANDIR
GFYTPYEEGLPGPIFTESEALIKYIENKYYETLPLDDKYINFNKKYNYLDDGKATNRVGN
EIIASLQTKKGLR

Enzyme Prediction     

No EC number prediction in MGYG000000010_01833.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	4.34e-111	121	482	5	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.61e-75	97	478	3	380	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE58359.1	7.24e-106	37	482	279	714
ASF19349.1	7.24e-106	37	482	279	714
BAE17349.1	7.24e-106	37	482	279	714
QKV10378.1	7.24e-106	37	482	279	714
QCY41535.1	7.24e-106	37	482	279	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	3.06e-104	98	482	326	714	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	3.31e-103	98	482	326	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	9.19e-103	98	482	326	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	1.39e-103	98	482	326	714	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	1.59e-97	97	483	8	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	2.94e-90	98	483	6	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	1.50e-84	97	483	359	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKJ2	3.51e-31	204	483	335	604	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000010_01833.