CAZyme Information: MGYG000000011_02407

Basic Information

• Species: Staphylococcus xylosus_B
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus xylosus_B
• CAZyme ID: MGYG000000011_02407
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		92515.16	9.2657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000011	2927352	Isolate	United Kingdom	Europe

• Gene Location: Start: 86860; End: 89205 Strand: -

Full Sequence      

MNINILGFNIFAKGGTSRSNINLIKSFLKQGYTVNYFNNLDFDQDAITRLFIHENIDNEN
LNIYKFRDIKLLSKCDVLIITREDLFHYAKDVKAINKSTKVIGEIHGPMEYIDDSIDLCL
EAIDGVRVSTEGIKQRFICKYNYKSVFNKYVNAEHIKINKEPINTKRNLLIKARFEDGIK
DISYVIKLVNYIIKNTERDDIQLYIVGYGPSEALYKNLVNYYNLQDNIHINEKEPLNYIY
ISSSPYETLGYSILETLARGNRALIYPGNDDVLKEVYDKYYGIQFLEKNLSRDSKLLLSM
LNNKYSKENRLTDVEVLNTEFLDSEYSNQYLKQFKKASQNKRPLVPTKYKKRVRLQPKNK
IEKLDSGRVLYKDLKEKPFLSKVLKNNIFFEGFKKYYNNRKERLSKKILDNIEPKESNVF
IESFHGNNFSGDPKYIALSIQKNYPQKNIFVSSANSLVDIEIRNYGFKPIRFGTEEYKNK
FRQCKYVFMNSNSWDKVYKHTDQEFVQTWHGFPLKKMVNDLGDEKERKDQLKQFRPRMKK
WDYLLTSSKMNTMLLESAFNLKDNENLQILDYGAPRNEYLLNQVTKEERKKLQRKYLFTT
NEDKKYILFCPTWRKKERENLTSIDLVKLLEYLPKEYEIIVKLHPNEGMLRSKYNSLDAR
IHCFYNEFVDIQELYILCETMITDYSSTIFDFAHLNKPILLLQEDVEMYQKDIGFYFNIF
ELGHFPIVSLDEEKLALQLKGMNYMDYSKIVNRLISKDSKESSQQILKTVFEETNSNGMD
K

Enzyme Prediction     

No EC number prediction in MGYG000000011_02407.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	9.10e-49	414	772	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.31e-29	414	773	23	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd03820	GT4_AmsD-like	2.79e-12	3	260	2	279	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	4.13e-10	14	275	12	303	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03817	GT4_UGDG-like	3.17e-07	83	312	120	355	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AID00577.1	0.0	1	781	1	781
ARD73595.1	0.0	1	781	1	781
AID43641.1	0.0	1	781	1	781
QDW90045.1	0.0	1	781	1	781
QRA16338.1	0.0	1	781	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	6.10e-38	275	766	207	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	4.60e-37	275	766	207	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.09e-36	275	766	207	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	3.18e-37	275	766	207	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	1.13e-34	407	744	22	363	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	2.57e-32	270	771	237	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	9.62e-27	407	771	19	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	1.43e-18	499	767	115	373	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000011_02407.