CAZyme Information: MGYG000000012_00437

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_00437
• CAZy Family: GT1
• CAZyme Description: Oleandomycin glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000000012_1|CGC4	43864.43	4.6338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 399699; End: 400877 Strand: +

Full Sequence      

MKKYHISMINIPAYGHVNPTLALVEKLCEKGHRVTYATTEEFAPAVQEAGGEALIYHTSL
NIDPKQIREMMEKNDAPLSLLKESLSILPQLEELYKDDQPDLIIYDFVALAGKLFADKFN
VPVIKLCSSYAQNESFQLGNEDMLKKIKEAEAEFKAYLEKEQLPAVSFEQLAVPEALNIV
FMPKSFQIQHETFDDRFCFVGPSLGKRTEQESLEMKKGDQPLMLISLGTAFNAWPEFYKM
CIEAFRNSSWQVVMSVGKSIDPESLDDIPAHFTIRQSVPQLEVLEKADLFISHGGMNSTM
EAMNAGVPLVVIPQMYEQELTAKRVDDLGLGVYLPKEEVTVSSLKEAVQAVSGDQELLSR
VKNMQKDVKEAGGAERAAAEIEAFMKKSAVPQ

Enzyme Prediction     

No EC number prediction in MGYG000000012_00437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	211	385	6.1e-44	0.418848167539267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	0.0	9	369	1	374	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	1.79e-87	3	369	1	383	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	3.46e-69	4	351	1	372	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	4.70e-21	15	366	11	336	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PHA03392	egt	7.09e-14	101	366	138	444	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB60493.1	3.71e-281	1	392	1	392
AUS13451.1	5.27e-281	1	392	1	392
QRZ94210.1	8.74e-280	1	392	1	392
AFI27871.1	1.76e-279	1	392	1	392
AUZ38153.1	8.02e-276	1	392	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQX_A	2.75e-266	1	392	1	392	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQW_A	7.29e-263	1	387	1	387	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	1.63e-89	5	381	14	415	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	5.15e-79	2	385	3	397	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
3RSC_A	7.93e-75	5	388	22	415	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	1.51e-265	1	392	1	392	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	7.07e-155	5	390	5	395	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q53685	1.13e-63	5	383	9	396	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1
Q9XC67	2.59e-62	5	389	60	461	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1
Q54387	3.52e-62	5	383	24	411	Macrolide glycosyltransferase OS=Streptomyces lividans OX=1916 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000012_00437.