CAZyme Information: MGYG000000012_00998

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_00998
• CAZy Family: GH11
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MGYG000000012_1|CGC8	25663.86	9.8841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 1006095; End: 1006793 Strand: +

Full Sequence      

MKQKRMKFLLAVLFSLALTLPAWSAQAATTITSNQTGSQDGYDYELWKDYGNTSMTLNSG
GAFSAQWSNIGNALFRKGKKFDTTKTHSQLGNISIRYNATFNPGGNSYLCVYGWTKDPLV
EYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGIATFKQYWSVRQTKRTS
GTVSVSEHFKKWGSLGMPMGKMYETALTVEGYQSNGSANVTTNVLTVGGKSQ

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	40	221	5.9e-77	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	1.10e-87	40	219	1	175	Glycosyl hydrolases family 11.
PRK06215	PRK06215	0.006	1	185	8	192	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS13960.1	3.56e-169	1	232	1	232
ASB61035.1	1.45e-168	1	232	1	232
QRZ94754.1	5.91e-168	1	232	1	232
QJC96409.1	1.10e-165	1	230	1	230
AEP86749.1	2.58e-165	1	232	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IGO_A	2.01e-145	28	230	1	203	Family11 xylanase [Bacillus subtilis],1IGO_B Family 11 xylanase [Bacillus subtilis]
2DCJ_A	4.46e-111	1	231	1	231	Atwo-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],2DCJ_B A two-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],2DCK_A A tetragonal-lattice structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1]
6KKA_A	2.82e-108	31	231	2	204	XylanaseJ mutant from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],6KKA_B Xylanase J mutant from Bacillus sp. 41M-1 [Bacillus sp. 41M-1]
6KJL_A	4.14e-108	31	231	3	205	XylanaseJ from Bacillus sp. strain 41M-1 [Bacillus sp. 41M-1],6KJL_B Xylanase J from Bacillus sp. strain 41M-1 [Bacillus sp. 41M-1]
2F6B_A	1.03e-106	29	229	1	203	Structuraland active site modification studies implicate Glu, Trp and Arg in the activity of xylanase from alkalophilic Bacillus sp. (NCL 87-6-10). [Bacillus],2F6B_B Structural and active site modification studies implicate Glu, Trp and Arg in the activity of xylanase from alkalophilic Bacillus sp. (NCL 87-6-10). [Bacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00694	2.39e-126	1	228	1	227	Endo-1,4-beta-xylanase A OS=Bacillus pumilus OX=1408 GN=xynA PE=1 SV=2
P17137	4.55e-106	19	228	49	260	Endo-1,4-beta-xylanase OS=Clostridium saccharobutylicum OX=169679 GN=xynB PE=3 SV=1
Q8GJ44	1.54e-99	11	228	14	232	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2
P83513	2.80e-98	15	231	2	219	Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans OX=185007 GN=xyn11A PE=1 SV=2
P33558	3.60e-96	11	228	14	233	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.998970	0.000184	0.000228	0.000177	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000012_00998.