CAZyme Information: MGYG000000012_01402

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_01402
• CAZy Family: GH18
• CAZyme Description: Putative sporulation-specific glycosylase YdhD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000000012_2|CGC5	38916.44	10.0876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 322673; End: 323707 Strand: -

Full Sequence      

MKKWLIIAVSLAIAIVLFMYTKGEAKAAGMTLGYTTGDTASYNSLTKYHTYMNTIATDTF
AFEKNGQIIGDAPSKQLTYANKKKIKTWAVISNYNDAIYDFDGDLASRVMSNKTAKKRFT
DQLISLAKKHSYYGINIDFEAVNPEDRSKYSRFIQDVSQALKKKHIQTMVSVPAKSADDK
NDDWSWPYDYAKIGKYANFVQVMTYDEHGIWGEPGSVASTNWIKSSLQFSVKKIKANKVI
MGIPAYGYDWDVKDGSGSSVREWNELKSLIQKQKAKPAFNKKAGSMTFSYVDKKKHKHVV
WYENEKTVQTKSHLAKQYKIAGVSVYALGNESESFWKAIQKGTK

Enzyme Prediction     

No EC number prediction in MGYG000000012_01402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	33	332	1.3e-42	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3858	YaaH	3.27e-138	1	340	71	419	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd02874	GH18_CFLE_spore_hydrolase	2.42e-123	28	339	1	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	2.01e-38	71	336	46	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	7.52e-35	75	329	55	332	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.66e-34	75	330	54	306	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFI29979.1	3.80e-252	1	344	1	344
AUZ40472.1	3.00e-249	1	344	1	344
AUS11517.1	4.26e-249	1	344	1	344
QRZ92269.1	3.50e-248	1	344	1	344
ASB62487.1	1.36e-246	1	344	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	6.62e-59	28	342	1	313	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	2.75e-42	25	344	1	340	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
3CZ8_A	6.41e-37	48	328	29	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3K_A	1.49e-34	43	344	129	428	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	4.16e-29	90	339	172	421	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	2.06e-241	1	344	1	344	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	1.75e-35	48	328	121	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	1.96e-32	51	336	130	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	4.43e-29	90	339	171	420	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.59e-28	43	339	123	420	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998909	0.000222	0.000188	0.000181	0.000164

TMHMM  Annotations     

start	end
4	21