CAZyme Information: MGYG000000012_03330

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_03330
• CAZy Family: GT2
• CAZyme Description: Tyrocidine synthase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
889		100061.21	5.0447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 100608; End: 103277 Strand: +

Full Sequence      

MNQTDVFQLKTAALEKVKERQYWTSVLTQIPSDCRFPYDSQLLDQNDEEASIPFSFPAQL
EKAILKASGASDLRIFMILMTAAVTLLHRYDGRTDIMASAPVLRQRETQPVINDLLPLLV
KINPSMSFRDCLEHVKQAFQEVYAHQNFPVKILLDELHPLHKKGEPRFGISLAVNDLQQP
VSLKALDTNLFFSIQCDEGRLTGKLSWNLKHYTFDTAERIAGHFCMLADQALSAPETLVS
ELQLLSHEERERVITTFNHTNQPYPKEKSIVDLFKEQAALKPDQPAIVYEDVSFTYGEAD
ELSDRIAAFLTKEGVCHEEPVGLMVHRSAEMVIGILGILKAGCPYLPIDVNMPSERMDYM
LTNSGSRFVITNKGYGTSAENQKSLCIEEMMKFEGAAEHGRLPSPENLAYVLYTSGTTGK
PKGVMVEHRQVINLVYGIDSLHFQPFSHEHLRIGMLASHIFDASVQTIFPAVLLGHTLYI
APDHARMDGKQLWSFYEENRIHISDATPSHLRLMIKAAEKEPHHVDELKLIMAGGEMLPP
QLVQQYLQTFRAGKPVMTNNYGPTECAVQSAAFTIPDSWNEPVVPIGRPMPNEQIYILDH
CGQPVPIGVYGELCIAGDGVARGYIRQPELTAEKFTEPQHIPAGKLYHTGDLARWRSDGF
IEFFGRYDDQVKIRGFRIELDEIRKALLDYREPGKIVHDAVIIPVQKESDDPFLVAYLIS
DQKLKTRKMRGFLGEKLPGYMIPRRFIRVDSFPMNLSGKLDLKALPDPFEEPESDEQVIK
PHNETEKKLVSIFAGILNIPESDISMEDNFFDIGGNSFHIVELSNKLKEQFGQELSVVQL
FQYTSVSAIAAQLSRQAESEGCQANAESEEEAAEDLENVAQLLGGISDE

Enzyme Prediction     

No EC number prediction in MGYG000000012_03330.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17655	A_NRPS_Bac	0.0	273	768	2	489	bacitracin synthetase and related proteins. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes bacitracin synthetases 1, 2, and 3 (BA1, also known as ATP-dependent cysteine adenylase or cysteine activase, BA2, also known as ATP-dependent lysine adenylase or lysine activase, and BA3, also known as ATP-dependent isoleucine adenylase or isoleucine activase) in Bacilli. Bacitracin is a mixture of related cyclic peptides used as a polypeptide antibiotic. This family also includes gramicidin synthetase 1 involved in synthesis of the cyclic peptide antibiotic gramicidin S via activation of phenylalanine. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
cd05930	A_NRPS	0.0	282	765	1	444	The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
cd12117	A_NRPS_Srf_like	8.51e-161	272	765	1	483	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and, in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the adenylation domain of the Bacillus subtilis termination module (Surfactin domain, SrfA-C) which recognizes a specific amino acid building block, which is then activated and transferred to the terminal thiol of the 4'-phosphopantetheine (Ppan) arm of the downstream peptidyl carrier protein (PCP) domain.
PRK12467	PRK12467	7.05e-159	18	860	236	1104	peptide synthase; Provisional
COG1020	EntF	1.76e-151	56	690	1	641	Non-ribosomal peptide synthetase component F [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ00088.1	4.41e-131	22	850	318	1175
BAZ75991.1	4.41e-131	22	850	318	1175
BAY90071.1	2.72e-130	7	850	299	1174
BAY30132.1	1.41e-128	22	850	318	1177
AFZ04852.1	1.24e-120	22	856	323	1186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MFZ_A	1.94e-116	65	850	1005	1794	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
2VSQ_A	7.55e-116	15	853	194	1039	Structureof surfactin A synthetase C (SrfA-C), a nonribosomal peptide synthetase termination module [Bacillus subtilis]
1AMU_A	1.80e-109	246	797	18	555	PhenylalanineActivating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine [Brevibacillus brevis],1AMU_B Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine [Brevibacillus brevis]
6MFY_A	2.12e-106	65	768	1005	1715	Crystalstructure of a 5-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis],6MG0_A Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis],6MG0_B Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis]
5U89_A	1.22e-104	248	853	5	602	Crystalstructure of a cross-module fragment from the dimodular NRPS DhbF [Geobacillus sp. Y4.1MC1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O68006	1.64e-141	15	827	2876	3704	Bacitracin synthase 1 OS=Bacillus licheniformis OX=1402 GN=bacA PE=3 SV=1
Q9R9J0	6.33e-140	200	860	3216	3879	Mycosubtilin synthase subunit B OS=Bacillus subtilis OX=1423 GN=mycB PE=3 SV=1
O30409	8.46e-138	18	857	3305	4150	Tyrocidine synthase 3 OS=Brevibacillus parabrevis OX=54914 GN=tycC PE=1 SV=1
P27206	1.11e-134	18	850	194	1039	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4
P0C064	6.53e-130	18	856	3316	4163	Gramicidin S synthase 2 OS=Brevibacillus brevis OX=1393 GN=grsB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000012_03330.