CAZyme Information: MGYG000000012_03384

Basic Information

• Species: Bacillus subtilis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus subtilis
• CAZyme ID: MGYG000000012_03384
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	MGYG000000012_4|CGC2	49064.87	5.7506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000012	4053580	Isolate	United Kingdom	Europe

• Gene Location: Start: 176922; End: 178253 Strand: +

Full Sequence      

MSTLHQIKIAYIGGGSQGWARSLMSDLAIDERMSGMVALYDLDFEAAQRNEVIGNYSGNG
KWRYEAVSTLKKALSGTDIVIISILPGSLDDMEIDVHLPERCGIYQSVGDTVGPGGIIRG
LRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRALYKVFPGIKAIGCCHEVFGTQKLL
AEMVTERLGIEVQRREDIHVNVLGINHFTWITAASYRHIDLLPIFREFSSHYGESGYELE
GESWRDSVFHSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPISFRK
QDRALKRQETERFIQQQRGVAGKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSNLPIQ
AIVETNAFITRNSVKPIFSGALPKGVEMLAARHVSNQEAVAEAGLTKDTGLAFQAFLNDP
LVMIDRNDAEQLFDDMHQSTIQS

Enzyme Prediction     

No EC number prediction in MGYG000000012_03384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	8	183	1.3e-52	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	7.78e-167	7	436	1	419	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.29e-146	6	436	3	428	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	1.53e-80	8	186	1	183	Family 4 glycosyl hydrolase.
PRK15076	PRK15076	9.76e-70	8	436	3	419	alpha-galactosidase; Provisional
cd05296	GH4_P_beta_glucosidase	4.90e-54	7	436	1	411	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS12981.1	0.0	1	443	4	446
AFI27344.1	0.0	1	443	1	443
ASB60018.1	0.0	1	443	4	446
QRZ93682.1	0.0	1	443	4	446
AUZ37634.1	0.0	1	443	4	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.99e-293	3	443	2	442	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.43e-31	6	436	4	426	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	2.24e-29	6	435	7	428	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
6DUX_A	2.08e-20	73	403	77	399	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]
1OBB_A	6.46e-19	7	425	4	454	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39130	1.44e-301	1	443	4	446	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
I3VRU1	2.25e-171	4	440	8	454	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	9.20e-168	7	436	11	442	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	7.69e-160	7	440	11	456	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
O34645	1.04e-44	8	420	3	402	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000012_03384.