CAZyme Information: MGYG000000013_00072

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00072
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896		103091.78	6.3136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 93035; End: 95725 Strand: -

Full Sequence      

MHISIMKKFFYIFILLLIVGWAQAQQRVVYTINDGWKFTKGSPFEAQLAGCDDSSWETVN
IPHTWNDKDADDETPGFYRGPAWYRKQLFVDKSQEGRQAVIYFEGANQEVQCYLNGQFVG
EHKGGYTRFCFDITSHLRYGQENLFAIYVNNVYNPNIPPLSADFTFFGGIYRDVYLQFMN
PVHIATNDYASSGVYIRTPEVNNSAASVEITTLLTNNTLQPAEIRVENVICDADGREVKK
THAEVKLASGETKTDISKKIKIDSPRLWDIDDPYRYMVYTRILDKKKGALLDEVVNPLGL
RWFKFDSEKGFFLNGKGRKLIGTARHQDYFQKGNALRDELHVQDVLLLKEMGGNFLRVSH
YPQDPVIMEMCDKLGIVTSVEIPVVNAVTETEEFLQNSVEMAKEMVRQDFNRPSVMIWGY
MNEIFLRRPYTEGKQLENYYRFTEKVARALEATIREEDPSRYTMMAYHNMPQYYEDAHLT
EIPMIQGWNLYQGWYEPDINEFQRLLDRAHKVYKGKVLMVTEYGPGVDPRLHSYQSERFD
FSQEYGLVYHKHYLREMMKRPFIAGSSLWNLNDFYSESRVDAVPHVNNKGVVGLDREKKD
VYWFYKTALSRRPILVIGNREWKSRGGVVNTAQKECIQSVPVFSNAEEVELFVNNKSLGK
KKVEDNYALFDVPFVGGENLLEAVAVASGHKLRDMLRIQFQLVGSQLKDEAVPFTEINVM
LGSPRYFEDRSANVAWIPEQEYKPGSWGFVGGTSYRRKTGFGSMLGSDIDIHGTDMNPVF
QTQRVGIKSFKADVPDGEYSVYLYWAELESDKEREALVYNLGADSEQTFAGNRSFGISIN
GTTVSDDFNVARDYGYARAVIKKFVITVKDGKGLSVDFHKKEGEPILNAIRIYRNY

Enzyme Prediction     

No EC number prediction in MGYG000000013_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	641	1.7e-98	0.651595744680851
CBM57	719	890	2.8e-30	0.9727891156462585

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	3.02e-60	23	606	6	589	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.30e-53	27	610	10	596	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.61e-31	84	423	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.17e-24	311	574	8	265	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	3.17e-22	31	176	3	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73216.1	0.0	6	896	1	891
QRM98825.1	0.0	6	896	1	891
SCV07913.1	0.0	6	896	1	891
CBK69678.1	0.0	6	896	1	891
QRQ55339.1	0.0	6	896	1	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5UJ6_A	2.29e-202	26	896	24	878	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	2.93e-202	26	896	32	886	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	7.24e-200	26	896	32	886	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6ED1_A	7.27e-198	31	892	28	875	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3FN9_A	4.56e-111	27	694	5	659	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	7.74e-99	16	710	35	736	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.33e-64	27	656	3	579	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	1.09e-58	24	679	23	662	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.02e-56	33	666	48	704	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	6.05e-51	26	689	45	697	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999180	0.000162	0.000142	0.000136	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00072.