CAZyme Information: MGYG000000013_00073

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00073
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		90861.52	5.5927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 95730; End: 98087 Strand: -

Full Sequence      

MKSLNNWLLVLLVLSCFGCSSPVHEDGRGCAFVSDSIQYRVEFMSAGCVRILSFPQGDTL
ITKRLVVDAEKPAFKDYKWEDTGQKLFFRTRELSVAFDKADAAFTFQEVSTGKLLLKEKG
DRKARNFKRSVAGGEQCLEVTQRFVPTDDEAIYGLGQYQNGIMNYRGKSVLLLQANMDIV
NPFLISTNGYGVLWDNYSSTKFEDTKEGYSFTSEVGDASDYYFVYGKDMDEVVAGYRELT
GDVPMFGKWVYGFWQSKERYKSFDELKAVVKEYRKRGIPLDNIVQDWEYWGDKPHWNSLT
FHPANFNHPRQVIDELHQQDHVHFMLSVWPGFGPETAVYQSLDSIGALFSEPTWAGYKVF
DAYNPVARDIFWQYLKKGLYDMGVDAWWMDATEPSFRDGFTQLKQEEKTKSAGNTYLGSF
HRYLNTYSLEMLKDFYQRLRAESDQKRIFILTRSAFASQQHYGTAVWSGDVSASWENMHK
QLVAGLNLSMSGIPYWTSDTGGFFVTERDAKYPDGLKSNDYKELYSRWFQFSAFTPIFRA
HGTNVPREIWQFGEKGTLFYDNQVKYIHLRYRLLPYIYSMSHQVTANNYTMLRGLAMDFT
TDTRTFDIDNAYMFGTSLLVRPVFRPQSEEKNVSIYLPEHSGKYWYDFWTGEAFEGGREQ
MQTSILDILPLYVKAGSILPLAEVKQYAMEYPDRELELRIYGGADASFLWYEDEGDSYRY
EEGVCSKVPVQWKDSERTLTIGLREGTYPGMPEQIKVHMKLYLPEGAAFESKECVYTGRE
VKIKF

Enzyme Prediction     

No EC number prediction in MGYG000000013_00073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	221	679	1.1e-137	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	2.85e-167	222	679	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06591	GH31_xylosidase_XylS	1.32e-157	241	570	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	3.13e-156	92	766	110	755	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06598	GH31_transferase_CtsZ	1.68e-68	248	583	8	332	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06604	GH31_glucosidase_II_MalA	3.83e-64	241	583	1	334	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40761.1	0.0	1	785	1	785
ALJ48502.1	0.0	1	785	1	785
QRQ55338.1	0.0	1	785	1	785
QUT27035.1	0.0	1	785	1	785
QUT78438.1	0.0	1	785	1	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMP_A	2.11e-153	40	760	80	946	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5JOU_A	5.41e-152	35	784	32	954	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	1.07e-140	40	784	69	985	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	2.38e-71	145	758	151	776	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	3.03e-70	145	758	151	776	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9P999	2.86e-177	36	780	5	724	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A7LXT0	4.85e-153	1	784	5	953	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9F234	5.71e-77	31	748	39	745	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q01336	5.68e-68	125	547	123	528	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
A2QTU5	7.50e-60	133	672	150	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.142130	0.857360	0.000054	0.000077	0.000072

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00073.