CAZyme Information: MGYG000000013_00310

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00310
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000000013_1|CGC10	77517.09	6.1041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 426941; End: 428995 Strand: -

Full Sequence      

MKIIKTKVFFASIVFGIAVTACAPAPTSGTVTVVDRPDIQSVNTNYTGYRAPLRPLNFIK
LPVGSIQPEGWVKKYLELQRDGLTGHLGEISAWLEKDNNAWLTTGGDHGWEEVPYWLKGY
GNLAYILNDPKMIEETKYWIEGVFASRQPDGYFGPVNERNGKRELWAQMIMLWCLQSYYE
YSQDQRVIDLMTNYFKWQMTVPDDQLLEDYWEKSRGGDNIISIYWLYNHTGDAFLLELAE
KIHRNTADWTKSTSLPNWHNVNIAQCFREPATYYMQTGDSAMLKASYNVHHLIRRTFGQV
PGGMFGADENARLGYIDPRQGVETCGLVEQMASDEIMLCMTGDPMWAEHCEEVAFNSYPA
AVMPDFKALRYITCPNHAISDSKNHHPGIDNRGPFLSMNPFSSRCCQHNHAQGWPYFTEH
LVLATPDNGVATAIYAACKATVKVGDGKEITLHEETNYPFEESIAFSVSTGEKATFPFYL
RIPSWTKGAEVRVNGKKVNVAPVAGKYLCIHREWSNGDRVQLMLPMSLSMRTWQVNKNSV
SVDYGPLTLSLKIAEKYVEKDSRETAIGDSKWQKGADPQKWPTTEIYPDSPWNYSLVLDK
TEPLKNFKVIRKSWPADNYPFTVASVPLEVKATGRLVTEWKIDETGLCGVLPEEDAMKGD
KEEITLIPMGAARLRISAFPNTRE

Enzyme Prediction     

No EC number prediction in MGYG000000013_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	322	548	5.3e-34	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.08e-163	31	550	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.22e-21	109	554	57	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APS23119.1	4.40e-175	45	680	43	665
AWL89945.1	1.39e-173	45	680	43	665
QXQ95199.1	3.79e-173	20	680	15	665
QKW18167.1	1.43e-172	51	682	56	670
QNQ38172.1	5.98e-172	45	680	43	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.95e-22	112	552	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.02e-20	112	552	78	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.27e-15	323	552	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000033	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00310.