CAZyme Information: MGYG000000013_00326

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00326
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	MGYG000000013_1|CGC10	69142.65	7.9994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 454350; End: 456179 Strand: +

Full Sequence      

MYTMNMKKNFLTMLLALALCSSTFAQWKPAGDKIKTSWGEQLDPKNVLPEYPRPIMERSD
WKNLNGLWKYAITKKGAPAPAAYQGDILVPFAVESSLSGVGKMINEKEELWYQRTFDVPS
NWRGKQVLLHFGAVDWKAEVWVNDVKVGEHTGGFTPFYFDITSVLNKGNNDLVVKVWDPS
DRGEQPRGKQIANPHGIWYTPVTGIWQTVWLEPVAAQYIANLKTTPNIDNNSVKVEVAAN
TTSADKVEVKVFDGKNLVAKGAALNGVPVELAMPANAKLWSPDSPFLYNMEVTLYKDGKA
IDQVKSYTAMRKYSIRKGPNGITRLQLNNKDYFQFGPLDQGWWPDGLYTAPTDEALVYDL
KKTKDFGYNMVRKHVKVEPARWYTHCDQLGLIVWQDMPNGGPSPQWQARNYFNGTEVIRS
AASEANYRKEWKEIIDCLYSYPSIAVWVPFNEAWGQFKTPEIVAWTKEYDPSRLVNPASG
GNHYTCGDILDLHHYPGPNMFLYDPRRATVLGEYGGIGLVVEGNTWVNDKKNWGYVKFNT
SDEVTNEYIKYGRHLLELIQKGFSAAVYTQTTDVEGEINGLLTYDRKVIKMDEAKIREIN
QKICNSLNK

Enzyme Prediction     

No EC number prediction in MGYG000000013_00326.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	55	488	4e-106	0.4933510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.21e-40	59	603	10	558	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	8.31e-33	53	476	3	449	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	2.19e-19	62	211	2	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10340	ebgA	9.42e-19	59	393	39	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	2.79e-14	218	311	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40497.1	0.0	6	609	1	604
SCV07657.1	0.0	4	609	1	606
ALJ48248.1	0.0	4	609	1	606
CBK67834.1	0.0	1	609	1	609
QRQ55099.1	0.0	6	609	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	0.0	25	609	3	588	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED2_A	7.91e-30	51	452	30	441	ChainA, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
3GM8_A	3.09e-29	111	491	69	435	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6ED1_A	4.59e-29	111	474	80	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3FN9_A	1.01e-27	111	590	63	569	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	2.37e-29	111	599	106	556	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	8.44e-28	111	453	59	389	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	2.74e-26	111	480	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q48727	1.01e-23	112	488	111	460	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3
Q56307	3.29e-23	32	476	16	465	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001256	0.937352	0.060546	0.000345	0.000236	0.000224

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00326.