CAZyme Information: MGYG000000013_00598

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_00598
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	MGYG000000013_2|CGC4	47624.74	6.5847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 153956; End: 155215 Strand: -

Full Sequence      

MKNSPVQSHVLRLAHPPIPTVRIGIIGLGNRGLLTLQRYLQIEGVEIKALCEIREGNLSK
AQQLLKEAGRSEATGYTGVEGWKKMCESDEADLIFICTDWLMHTPMATFTMECNKHVAIE
VPAAMSVEECWQLVDTAEKTRRHCIMLENCCYDPFALMTLNMAQRGLFGEIMHVEGAYIH
DLRSMYFAEESEGGYHNHWGKRYSIEHTGNPYPTHGLGPACQILDIHRSDRMEYLVSMST
HQAGMSEYARRLFGEYSPEAHQKYQLGDVNTTLIHTLKGKTIMLQYAISTPRPYSRLQTI
CGTLGFAQKYPVPCIALDPNGDTPLEGELLEKMMARYKHPFSATIGEEAHRRGLPNEMNY
VMDYRLIHCLRNGLPLDMDVYDAAEWSCITELSEKSVLNKSMAVEIPDFTRGAWKKYKY

Enzyme Prediction     

No EC number prediction in MGYG000000013_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	18	416	2.8e-165	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.30e-16	19	181	2	158	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.09e-09	21	146	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL36575.1	0.0	1	419	1	419
QGT73650.1	0.0	1	419	1	419
ALJ49110.1	3.62e-317	1	419	1	419
QRQ55914.1	3.62e-317	1	419	1	419
QDM11792.1	3.62e-317	1	419	1	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.57e-80	16	415	38	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.99e-61	21	418	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	4.84e-07	25	175	10	150	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZW9	2.48e-280	1	419	1	419	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4252 PE=3 SV=1
Q5LGW9	1.34e-251	4	416	3	415	Alpha-N-acetylgalactosaminidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0874 PE=3 SV=1
Q64XS1	2.71e-251	4	416	3	415	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0955 PE=3 SV=1
A6KY05	1.08e-217	7	416	3	412	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
Q7MWF4	2.86e-141	7	418	44	460	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_00598.