CAZyme Information: MGYG000000013_01137

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_01137
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000013_3|CGC2	30433.51	7.6377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 106604; End: 107410 Strand: +

Full Sequence      

MKLNKIVCLAVLCSVGSRMTAQETYPFRNPQLSVEQRVDDLVSRLTLEEKVKQMLNSTPP
IDRLGIPAYNWWNECLHGIGRTKYHVTVFPQAIGMAAAWNDALIKEVASSIADEGRAIYN
DAQRKEDYSQYHALTYWTPNINIFRDPRWGRGQETYGEDPFLTSKIGESFVLGLQGDNPR
YLKASACAKHYAVHSGPEKNRHSFNSDVSTYDLWDTYLPAFRTLVVDAKVSGVMCAYNAF
QGQPCCGNDLLMQSILRDKWNFKGYGHF

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	265	9e-61	0.8425925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	1.35e-77	24	265	39	293	Probable beta-xylosidase; Provisional
COG1472	BglX	1.86e-48	53	265	47	244	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	8.48e-41	3	264	1	282	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	5.89e-38	63	264	63	249	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS34249.1	6.82e-130	4	265	7	272
AHW60588.1	1.36e-123	9	265	11	263
QJD97902.1	2.78e-123	7	265	12	272
QDO69751.1	1.06e-122	6	265	7	264
AHM63589.1	6.77e-121	25	265	33	274

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	7.03e-52	37	258	25	255	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	7.03e-52	37	258	25	255	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
6Q7I_A	4.61e-46	26	267	41	285	GH3exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7I_B GH3 exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7J_A Chain A, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4],6Q7J_B Chain B, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4]
5A7M_A	7.89e-46	36	267	51	287	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5A7M_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
5AE6_A	7.93e-46	36	267	51	287	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5AE6_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	4.03e-84	1	263	1	263	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
A5JTQ3	1.28e-65	10	265	37	299	Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia OX=36902 GN=Xyl2 PE=2 SV=1
A5JTQ2	2.48e-65	13	265	41	299	Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia OX=36902 GN=Xyl1 PE=1 SV=1
Q5ATH9	4.20e-64	26	268	37	284	Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bxlB PE=1 SV=1
Q9LXD6	1.78e-63	27	265	49	294	Beta-D-xylosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BXL3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999175	0.000179	0.000146	0.000141	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_01137.