CAZyme Information: MGYG000000013_01848

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_01848
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000000013_4|CGC3	42174.03	7.8211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 321707; End: 322813 Strand: +

Full Sequence      

MKKILALFLVSINCTLNAQQLFSSKMEKEDITKVCNAVSEWQISHHNEVKHNPLDWTNGA
LYRGMTEWGKVSGNQSCYDFVRTIGERHNWDMWNRVYHADDICVGQAFIEMYRRFDDKRM
LQPVMERAYYVASHPSKAPLQKTDAVGTTERWSWSDALFMAPPVYAALYTITGDKIFLNY
MDSEYRECVDSLYDKKEHLFYRDNKRIPLREKNGSKQFWGRGNGWVFAGLPLIVDNLPLN
CSSRDYYIRLFTEMAEAVRKTQCKDGDWRTSLLDPDSYNMPENSCSAFMCFGIAWGIRNG
YLPQRTYKPVLEKGWQSLVKAVHSDGKLGYIQPVGAAPKAAGFDATDVYGVGAFLLAGSE
LYKLSGAY

Enzyme Prediction     

No EC number prediction in MGYG000000013_01848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	363	5.5e-84	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.93e-88	31	364	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.51e-50	55	365	35	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH57430.1	4.09e-273	1	368	1	368
QUT45004.1	1.16e-244	1	363	1	363
QRQ49255.1	6.71e-244	1	363	1	363
QDO70976.1	6.60e-237	1	364	1	363
QRQ48187.1	1.96e-222	1	363	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.09e-75	40	364	38	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	8.13e-52	23	360	28	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.80e-44	17	360	2	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.40e-74	40	364	45	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.98e-74	40	364	43	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.73e-74	33	361	59	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000850	0.998126	0.000414	0.000202	0.000185	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_01848.