CAZyme Information: MGYG000000013_02164

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02164
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1169	MGYG000000013_5|CGC1	133870.84	6.8246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 98297; End: 101806 Strand: -

Full Sequence      

MKKRILYYLFILLLFPHNGTGQTVTRMSDRPVNTSQWITTHFARGVVPPFSFEYGGKPSQ
EFIKSWSYTATRQKSDDPKVLKYLYTYREPSGGLKVECEVKGFTNFNTVEWVLRFTNQGK
KNTPEIANVKVSDITFRYQHPGAFNLHHSEGSHASKSDFSQQLTILSPGDNLYMRPEGGR
SSQMRMPFFNIESPANQGVIVAIGWTGTWFADVCCADQQSVALTSGIERLKTYLYPEESI
RTSSVCLSFWNGSDRMKGHNQFRRFVQAHHTWKVDGKPTVYPISTSFNYGDPTPCNEYTC
LTTDYAIAMVKRYEQFKLVPEVFWLDAGWYNHSADVANHKNWANTVGNWTVDSIRFPEGL
RPIADEVHRVGSKFMVWFEPERVMKGSAWALQHPQWMLDARGKAKQEDWTKDGEHDSYLF
NLGNPEACRWMSKYIGDFLEENGIDYYRQDFNIEPEGFWAANDEPGRQGICEIRYIEGLY
SFWEYLLNRFPGLLVDNCASGGRRIDLESISRSAPMWRTDYSYGEPIGYQCHTYGLNLYL
PLHGTGTVSADKFTFRSSLGTSIIYNWKITEAGQSIYDMRDRQAEFKELRPYFYEDYYPL
SGINNITSENIWLVYQLYRPSDDSGYIVAFRRKDNPDKSYTVNLSGLHPDHTYILTNKDT
GEAIKKTGKELANGFTLTLDNPQSSLIIKYQSSTTAIQKLSVGKKTGVNLRAIGAELDPH
FLSQNVTRNDGAKAEDWDRIVVKRVKEMGLQSLRVMVMPQWYEPKNDNPDASKIEWHNFT
FDSLEMQSLYKVLDMAQEQKMEVTLVLWGAPPGHFLAEGNYGNWVVAPTNYEEWSENFSA
LVQHLLNNKKYTCIKEITPINEPDWSYIIKGKAAPTADYIEMCKVLDRRFKEDGIRHKVH
FSLSDNSDGGTGTHKYLAACTKGLANVADVFNSHTYIFGYETPNSTILDWEKQNSQLAAS
VGKVHFIGEFGGNQCVGATRQKDIDLYERGVLMTRIVINLLNAGASGVSYWSLIDQYYGK
DADYGAMQQLGLWKYVKKTYASEPYYNDIKSDYEVRPQYYAYSLLTRFIRPGAEIYPIAT
PEEWYAGTAVRNTNGKWVYVFANGMDQEKTISLINKHAQTNGNYKVYRYTKDSLPVTDQM
LPPDAEPLKVKDEIQCSIPPHSVVVLKQE

Enzyme Prediction     

No EC number prediction in MGYG000000013_02164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	84	671	4.6e-82	0.8255813953488372
GH30	732	1163	1.6e-21	0.8657074340527577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.71e-44	321	586	34	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	6.78e-32	321	593	73	344	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	6.26e-24	291	520	290	505	Alpha-galactosidase [Carbohydrate transport and metabolism].
COG1501	YicI	7.53e-07	310	480	286	437	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd14792	GH27	1.52e-04	323	374	40	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99265.1	0.0	1	1169	1	1169
QDH53807.1	0.0	1	1169	1	1169
CBK67650.1	0.0	1	1169	1	1169
QUT32037.1	0.0	1	1169	1	1169
QUT26596.1	0.0	1	1169	1	1169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3MI6_A	5.43e-29	181	657	225	697	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
2XN0_A	3.20e-23	317	520	361	552	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	7.34e-23	317	520	361	552	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
2YFN_A	2.81e-19	298	654	340	683	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
6PHU_A	1.61e-16	314	520	368	561	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43467	2.65e-27	288	653	328	692	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P43469	1.15e-24	151	520	195	542	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
G1UB44	1.75e-22	317	520	361	552	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q5AU92	1.83e-22	103	688	175	745	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
P27756	3.56e-21	314	689	348	713	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999141	0.000169	0.000138	0.000131	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02164.