CAZyme Information: MGYG000000013_02319

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02319
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	MGYG000000013_5|CGC5	84406.67	6.2646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 270379; End: 272562 Strand: -

Full Sequence      

MKRKSVYMCLVMFFMSLALQAKDKDVAVAEALVKRLLPSYIESFQFQKLKGEKDCFTVES
VKDKIVIGGNNANSMAMGLNHYLKYYCLTTVSWYADIAVEIPDELPMVGEKVVSEARVDT
RFFLNYCTYGYTMPWWQWKEWERFIDWMALNGINMPLAITGQEAVWYKVWSKMGMSDIEI
RSYFTGPPYLPWHRMANIDGWNGPLPMEWLEHQVSLQKKILARERELNMKPVLPAFAGHV
PADLKRIYPEADIQHLGKWAGFTDTYRCNFLNPNDALFAKIQKLFLDEQKKLFGTDHIYG
LDPFNEVDPPSFEPEYLRKIASDMYATLTAADPKAQWMQMTWMFYHDKEKWTSLRIEALL
TGVPQNKTYLLDYHCENIELWKTTDKFHGQPYIWCYLGNFGGNTTLTGNVKESGARLENA
LINGGDNLKGIGSTLEGLDVVQFPYEYILEKAWNLNVDDNKWIECLADRHVGCVSQPVRD
AWKILFNDIYVQVPRTLGTLPGYRPVLNKNSEKRTSNVYGNVELLEVWRKLNDAPSDRRD
AFRLDLITVGRQVLGNYFLDVKMEFDRMVEAKDYQALKACGEKMKEILNDLDKLNAFHPY
CSLDKWMDDARKMGDSPRLKDYYEKNARNLITTWGGSLNDYASRSWAGLISDYYAKRWEV
YINTFINAAEKGVEVDQKQLEDELKEIEAGWVNATDRKDIRKDVHSTNDGLLSFSTFLFS
KYQRLVK

Enzyme Prediction     

No EC number prediction in MGYG000000013_02319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	62	700	6.3e-231	0.9728506787330317

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	121	454	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	6.28e-78	462	697	1	244	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	3.71e-28	29	106	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26058.1	0.0	1	727	1	727
QDH53244.1	0.0	1	727	1	727
QUR45708.1	0.0	1	727	1	727
QGT72320.1	0.0	1	727	1	727
QUT79512.1	0.0	1	727	1	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.28e-127	24	697	4	691	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	6.18e-86	21	722	166	877	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.06e-86	21	722	174	885	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.36e-85	21	722	189	900	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	6.08e-128	24	697	27	714	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	9.11e-122	27	668	47	754	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999075	0.000186	0.000153	0.000139	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02319.