CAZyme Information: MGYG000000013_02363

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02363
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42753.27	8.0777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 340671; End: 341783 Strand: -

Full Sequence      

MKKTLLLGASLLCSVFIMATEIPFQKAEIKSIMRKVADWQIANPHPAPEHDDLNWPQGAL
YVGMVDWAELTEKEDGDDTYYKWLTRIGRRNCWQPDKRFYHADDIAVSQSFLDLYRKYKD
EAMIIPTLARTEWIVNHPSEGSFKLVEGDLKTLERWTWCDALFMAPPVYAKLYMLTGEKK
YIKFMNREYKATYGYLFDKEENLFYRDWRYFDKREANGKKVFWGRGNGWVLGGLVEILKE
LPKKDKNRKFYAELFVKLATRVAGLQHPDGFWHASLLDPASYPSPETSCTTFIVYSIAYG
INEGLLDKETYLPVLVKGWNALVSAVEPNGKLGYVQQIGADPKKVTRDMTEVYGVGAFLM
AGNEIYKMAR

Enzyme Prediction     

No EC number prediction in MGYG000000013_02363.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	367	2.3e-90	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.18e-104	32	368	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.39e-54	51	369	32	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99764.1	3.28e-282	1	370	1	370
QDH53356.1	9.41e-282	1	370	1	370
QUT26116.1	9.41e-282	1	370	1	370
QRQ54465.1	1.56e-280	1	370	1	370
SCV06959.1	1.56e-280	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	4.02e-79	24	368	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.42e-58	27	364	31	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.13e-49	65	364	65	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	7.40e-16	48	370	34	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.08e-15	48	370	24	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.70e-78	24	368	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.39e-78	27	368	32	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	9.04e-73	23	365	49	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	4.05e-15	48	370	34	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000939	0.998019	0.000366	0.000227	0.000220	0.000212

TMHMM  Annotations     

start	end
5	24