CAZyme Information: MGYG000000013_02389

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02389
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		43281.91	9.0647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 376586; End: 377689 Strand: -

Full Sequence      

MYKKVLILLFFVPFQLLFAQTSMLKDFPEGSTPEEIGKRLAYRFLTEKHALHIGKWIGYP
ETFYWNGALRYAYLAKDKELLNRLQDKFEPLFTEEKALQPIMNHVDVNMFGSLPLELYLV
TKDKKYWYLGLPYADSQWKVPANAKPEEKEWAEKGYSWQTRLWIDDMYMITIVQTRAYKV
TKDKKYIDRAAKEMVMYLDELQRPNGLFYHAPDVPYYWGRGNGWMAAGMTELLQCLPKNH
KDRPRILEGYRTMMESLKKYQNPEGLWNQLIDQSDCWTETSGSAMFTFAFIKGVKNGWLD
AEEYAPAARKAWMALVSYLNDKNQVREICVGTNKKNSKQYYYDRPRRTGDYHGQGPYLWC
AAALMEK

Enzyme Prediction     

No EC number prediction in MGYG000000013_02389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	364	2.3e-72	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.54e-52	58	362	28	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.50e-43	38	358	21	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH53377.1	1.90e-284	1	367	1	367
QUT26138.1	1.56e-283	1	367	1	367
QQR15953.1	1.73e-271	1	367	1	367
ANU59126.1	1.73e-271	1	367	1	367
QGT72398.1	9.70e-253	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.91e-37	162	366	199	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.16e-30	103	358	85	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.29e-30	103	358	75	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	9.55e-26	163	315	158	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.13e-23	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.19e-29	103	358	85	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	5.11e-18	163	328	201	378	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	7.19e-18	117	325	111	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	3.28e-17	133	325	139	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	5.78e-10	215	365	61	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999042	0.000194	0.000152	0.000152	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02389.