CAZyme Information: MGYG000000013_02653

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02653
• CAZy Family: GH28
• CAZyme Description: 3-oxoadipate enol-lactonase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		36711.2	6.5046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 152470; End: 153444 Strand: +

Full Sequence      

MNGRLLITALLNICFLTVSSKGLSGQESQDVFSSFYGSPVVSPTVMKGNLLVVKQGRINI
GNGFLYYEEAGQGEPIIFVHGHSLDHRMWDEQFSVFAKKYHVIRYDLRGYGLSSSQTEDY
QFTHAEDLVTLMDSLHIQKAHIVGLSLGGFITADMLAYFPERMLSAFLASGNIRKSKGPS
EPMTKEEAMRREEEIAALKEKGVEVMKKEWFEGLMKSGGTQRERMRAPLWQMIDEWDAWQ
PLHKEVRVVAGLDAIEMLKKNHPAVPALIVEGHSSGNRFSKEPQILNYLPNGKLKVIEDC
GHMMNMERPEEFNAALEDFLFRLH

Enzyme Prediction     

No EC number prediction in MGYG000000013_02653.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0596	MhpC	4.78e-35	65	323	12	282	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
TIGR02427	protocat_pcaD	7.07e-29	65	320	2	250	3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other]
pfam00561	Abhydrolase_1	1.30e-19	75	309	2	245	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
PRK14875	PRK14875	1.96e-16	57	320	113	368	acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
pfam12697	Abhydrolase_6	1.85e-15	76	315	1	212	Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62047.1	3.49e-157	46	320	511	785
QUT92203.1	1.97e-156	46	320	511	785
QOZ51862.1	8.70e-06	65	168	19	127

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EGN_A	2.35e-21	65	320	11	260	Est816as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_B Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_C Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_D Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_E Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_F Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_G Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_H Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium]
1HKH_A	1.17e-15	56	170	1	124	unligatedgamma lactamase from an Aureobacterium species [Microbacterium],1HKH_B unligated gamma lactamase from an Aureobacterium species [Microbacterium],1HL7_A Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.],1HL7_B Gamma lactamase from an Aureobacterium species in complex with 3a,4,7,7a-tetrahydro-benzo [1,3] dioxol-2-one [Microbacterium sp.]
3FOB_A	3.05e-15	65	320	19	279	Crystalstructure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_B Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_C Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames]
1BRO_A	7.37e-15	56	170	6	124	BromoperoxidaseA2 [Kitasatospora aureofaciens],1BRO_B Bromoperoxidase A2 [Kitasatospora aureofaciens]
1A7U_A	7.37e-15	56	170	6	124	ChloroperoxidaseT [Kitasatospora aureofaciens],1A7U_B Chloroperoxidase T [Kitasatospora aureofaciens],1A8U_A Chloroperoxidase TBENZOATE COMPLEX [Kitasatospora aureofaciens],1A8U_B Chloroperoxidase TBENZOATE COMPLEX [Kitasatospora aureofaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6F9F4	2.03e-15	62	320	11	259	(E)-2-((N-methylformamido)methylene)succinate hydrolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnD PE=1 SV=1
Q55921	6.19e-15	53	168	4	122	Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0314 PE=3 SV=1
P00632	1.40e-14	65	324	17	267	3-oxoadipate enol-lactonase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=catD PE=1 SV=3
O31168	4.09e-14	56	170	7	125	Non-heme chloroperoxidase OS=Kitasatospora aureofaciens OX=1894 GN=cpo PE=1 SV=1
P29715	4.09e-14	56	170	7	125	Non-haem bromoperoxidase BPO-A2 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999089	0.000200	0.000149	0.000153	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02653.