CAZyme Information: MGYG000000013_02662

Basic Information

• Species: Bacteroides sp902362375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902362375
• CAZyme ID: MGYG000000013_02662
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000013_6|CGC4	46248.49	6.4365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000013	6368149	Isolate	United Kingdom	Europe

• Gene Location: Start: 167606; End: 168826 Strand: +

Full Sequence      

MKKIVVGLAVMLGFCTCTHKPSGTLDVNKALDYCAAQAQRTLTELKTDSGIDYTMMPRNI
MADEHHWNCRKATKEEWCAGFWPGVLWYDYEYTQDKHILEEAKKFTNSLEFLSQIPAYDH
DLGFLVFCSYGNGYRLTKNPAYKKVILDTADSLSALFNPVVGTMLSWPREVEPRNWPHNT
IMDNMINLEMLFWAAKNGGNPYLYDIAVSHADKTMKCHFRPDYTSYHVAVYDTITGNLIK
GVTHQGYADSTMWARGQAWAIYGYTVVYRETKDPKYLDFAQKVTDVYLERLPEDKVPYWD
FDDPSIPNAPRDASAAAVVASSLLELSTYLPNGTGKRYRDAAVEMLTSLSSDNYQSGKSN
PSFLLHSVGHWPAHSEIDASIIYADYYYIEALLRLKRLQEGKNVIK

Enzyme Prediction     

No EC number prediction in MGYG000000013_02662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	71	395	3.5e-127	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.72e-13	76	310	28	252	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT82438.1	4.86e-300	1	406	1	406
QDM08508.1	4.86e-300	1	406	1	406
ALJ44715.1	6.91e-300	1	406	1	406
QRQ56392.1	6.91e-300	1	406	1	406
SCV09047.1	6.91e-300	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.68e-96	55	400	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	8.97e-59	76	397	41	366	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	4.90e-58	76	397	41	366	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	1.83e-55	76	394	67	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.87e-55	76	394	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.44e-89	71	398	71	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	4.91e-58	76	397	41	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	9.84e-56	26	394	29	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	1.02e-54	76	394	68	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	2.69e-54	76	394	66	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000058	0.022976	0.976967	0.000010	0.000014	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000013_02662.